KEGG   Lucilia cuprina (Australian sheep blowfly): 111681640Help
Entry
111681640         CDS       T06013                                 

Definition
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Pathway
lcq00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
lcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    111681640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 111681640
NCBI-ProteinID: XP_023299286
Position
Unknown
AA seq 631 aa AA seqDB search
MIINMKYFVYILTIIICIIKVQAELNKQPKELDETSKKSAESTTVPTTPAPPAKSINNNE
EYHEELVVQPLASGFINTYFQFTTRWYYGKRENLHNTRLIPRSIAEILLHSDVKELHISL
TQGLWRYESWGYPIVDNAPGAEAWAWFAGENLTSNSVDEQWKSVTSTFSGILCASLNFMD
KTNTITPNYGFQPHFVGPLAKNVKRHVRYSSLPREIVCTENLTPWKKLMPCNSKHGFASL
LNSGNVHNTNYHSLSIKVRTLCNAKDECILEFIESANLVYDPKLLGAANEYDFSLRRMFG
QGLNGYCALADSSKIYVNLQTPLPYEMIPLPHYNTTTTRGGYTSQFGVYDMQSSKESRLF
NIAWVLRRPQNTVLTASPPPLLTHRYIVGYGQERGKVITHLTNTHYNVLPIILQENIPWY
MPIYMHTLKIRDRLTGELITPKIINYRPGVQRERPYYLELAFKLPGKTSVEISFDFDYIF
LKWLEYPPDANHGHYVGSAVITTQLPIARNYSSIPLSGYRFADSFNASRNSYILTLRTET
LILSLPTPDFSMPYNVICLACTVVALAFGPIHSVATKRIVVEQQDTEGSQSFVGKFLKKL
RKSKNKTNDSNTSSKDAASEDENVTGEEQIK
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgattataaatatgaaatatttcgtgtatatattaacaataataatatgtattataaaa
gtccaagctgagctaaacaaacagccaaaagaattagatgaaactagcaaaaagtctgca
gagtcaacaacagttccaacaacaccagcaccaccagcaaagtccattaacaataatgaa
gaatatcacgaggaattagtagtgcaacccttagcttcgggttttataaatacctatttt
caatttaccaccagatggtattatggcaaacgggaaaatttacacaatactagattgata
cctagatctatagcggaaatccttttgcattcagatgttaaggaattgcacatttcctta
acccaagggctgtggcgttacgaatcatggggttatcctattgtagataatgctccgggt
gcagaagcttgggcttggtttgcgggagaaaatctaaccagcaactctgttgatgagcaa
tggaaaagtgttaccagtactttttcgggaattttatgtgcctctttaaattttatggat
aaaacgaataccataacccccaactatggttttcagccgcattttgtgggtcccctggct
aagaatgtcaaaagacatgttagatattccagtttaccgcgtgaaattgtttgcacggaa
aatctaacaccctggaaaaagcttatgccctgtaatagtaaacatggttttgcctcttta
ttgaattccggtaatgttcacaataccaattaccattcgctatcgattaaagtgcgtact
ttatgtaatgctaaggatgaatgcattttggaattcatagaatcggccaatttggtatat
gatcccaagttgttgggtgctgctaatgaatatgatttctctttaaggcgcatgtttggt
cagggtttaaatggttattgtgctctagccgattctagtaaaatctatgttaatctacaa
acacctttgccctatgaaatgatacccttgccacattataataccaccaccacgagagga
ggttatacttcgcaatttggtgtctacgacatgcaatcatcgaaagaatcaaggctattt
aatatagcttgggttttacgtagacctcagaatacagtattaacagcctctccgccacct
ctactaacacaccgttatattgttggctatggccaggaaaggggtaaagttattacccat
cttaccaatacacactacaatgtattgcctattatactgcaagaaaacataccctggtat
atgcccatctatatgcatactttaaagatacgtgatcgtcttacgggtgagctaataaca
cctaagattataaattatcgtccgggtgtgcaacgtgaaagaccctattacctggaattg
gcctttaaattacccggcaaaacttctgtggaaatatcttttgattttgactatatattc
cttaaatggctggaatatccccccgatgctaatcatggccattatgtgggttcagctgtt
ataactacccaattgcctatagcgcgcaattattcttctatacctttgtcgggttatcgt
tttgctgattcctttaatgcctcacgaaattcatacattttaacactgcgcactgaaacc
ttaatactttcattgcccacccccgattttagtatgccctacaatgttatttgtctggct
tgcacagtggtggctttagcctttggtcccatacatagtgtggctactaaacgtattgtg
gtagaacagcaggataccgagggtagccagtcgtttgtgggtaagtttttaaagaaatta
cgtaagtccaaaaacaaaacgaacgacagcaatacgtcaagcaaggatgctgccagcgaa
gatgaaaatgtcacgggggaagagcaaattaaatag

DBGET integrated database retrieval system