KEGG   Lucilia cuprina (Australian sheep blowfly): 111682909Help
Entry
111682909         CDS       T06013                                 

Definition
(RefSeq) aspartate--tRNA ligase, mitochondrial
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Pathway
lcq00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    111682909
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lcq01007]
    111682909
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lcq03016]
    111682909
   03029 Mitochondrial biogenesis [BR:lcq03029]
    111682909
Enzymes [BR:lcq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     111682909
Amino acid related enzymes [BR:lcq01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   111682909
Transfer RNA biogenesis [BR:lcq03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    111682909
 Prokaryotic type
   Other AARSs
    111682909
Mitochondrial biogenesis [BR:lcq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    111682909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon GAD tRNA-synt_2b
Motif
Other DBs
NCBI-GeneID: 111682909
NCBI-ProteinID: XP_023300673
Position
Unknown
AA seq 1051 aa AA seqDB search
MSGRQRSGGNSGRFGGNGGGGYGGGGYGGRGDYDNYGNGGYNGGGYNGNNGMNPFGNMPN
NMSGNDLMQIMNAMASGFNMNPPPPPPMRMGCGDLRVHHAGMFVELTGRLIKKRVTRFME
LRDRGNSACQLVVLEDRHPRVARRLINMPENTVISIVGLVQRRPRNSCNQTMPTGDIEVE
VQDILTIDFNSNSKRAGDKRSYSTMAQQNSTAITSTEYKIAKSENVLKYFENRDITCNDV
RRRDIGKDVTLVGWVPTGKTNKFIQLKDGYGQTQIIIEDQALQDTVTGAPEGTVIQVTGK
VLGRPRQNINMKYDTGEVEVMVEKVKILNPEDPYDGPIKEKDKVKKLSINDIDENAEGGE
AKNGEATEDGGNAKPAGSGNVIKVADLNKFANRTHTCGELTSDNIGEKVTICGWLEFQRM
GKFFILRDGYGQTQVLITDKTNGLEDNEQGIALESIVRVEGTVIPRPAATINPKMTTGHV
EIEAEKIEILNPAKRNLPFDVRKFNRAGERLRLTHRYIDLRFADMQHNLRMRSQVIMRMR
EYLINYLGFVEVETPTLFRRTPGGAQEFVVPTRKPGHFYSLVQSPQQFKQMLMAGAIDRY
FQVARCYRDEATRPDRQPEFTQLDIELSFTSRDDIMQLIEETLRYSWPKEYTKIQTPFKR
MTYNEAMEKFGTDKPDTRFSLALTNVTEIIKKNETFVEKFKDLGAYALIVRGNGGFWNGT
ARKHYESLSKEFSGTLFVRKFLQYKDLKDRLTNLLTADVASELITKYDLEENDLLFLGIG
EKVETQKLLGKIRVDYHNFLIENGRARKNYDNKFVWIIDFPMFELNPETGNLESVHHPFT
APHPDDMEDFINSKSEDLVNIRSQAYDLVLNGQEVGGGSIRIHDRDMQHFVLEQILKIPH
DHLAHLLNALESGCPPHGGIALGLDRLMAIICRAVSIRDVIAFPKSLNGRDPLSSAPVPI
SEEEKALYHLSILEGNGGGEEEAHGQEDTDPDAVRASPSPSAMDEDQAAVNEEEEMPVDE
EPPAAVEVKTEKKSPQKEETVKPKRAAKKKQ
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccgtcagcgtagtggtggtaatagtggtcgttttggtggcaacggtggtgga
ggttatggtggcggcggttatggtggccgtggtgattatgataactatggtaatggtggc
tataatggcggcggttataatggcaataatggaatgaatccttttggaaatatgcccaat
aacatgtccggaaatgatctcatgcaaataatgaatgcaatggctagtggttttaatatg
aatccaccaccgccaccgccaatgcgtatgggttgtggtgatttacgtgttcatcatgct
ggtatgtttgtagagctgacaggacgtttaattaagaaacgtgtaactcgttttatggaa
ttaagagatcgtggtaatagtgcctgtcaattagtagttttggaagatcgtcatcctcgc
gttgctcgccgtttaattaatatgcccgagaatacggtaatttctatagtaggtttagta
caaagacgtccgcgtaactcttgcaatcaaacaatgccaaccggtgacattgaggtggag
gtacaagatatacttaccatcgatttcaattcaaattctaaacgcgctggcgataaacgt
tcttatagtacaatggcccaacaaaatagtaccgctataactagtaccgaatataaaatt
gccaaatctgaaaatgtattgaaatattttgaaaatcgtgatataacttgtaatgatgtt
agacgtcgtgatattggtaaagatgtcacattagtaggctgggtacctaccggtaaaact
aataaatttattcaattaaaagatggctatggacaaacgcaaattattattgaagatcaa
gctttgcaagatactgtaactggtgctcccgagggtacggttatacaagttacaggcaaa
gttttaggtagacctcgtcaaaatataaatatgaaatacgacactggcgaagttgaagta
atggttgaaaaagttaaaattcttaatcctgaggatccctacgatggtcccatcaaggaa
aaagacaaggtcaagaaactttctattaatgacatcgatgaaaatgctgaaggtggtgaa
gccaaaaatggtgaagccaccgaagatggtggtaatgcaaaaccagctggctctggaaat
gttattaaagttgctgatctcaataagtttgccaatcgtactcatacatgtggtgaattg
actagtgataatattggtgaaaaggtgacaatatgtggctggttggaatttcaacgtatg
ggtaaatttttcatactacgtgatggttatggtcaaacacaggttcttataaccgataag
acaaacggtttagaggataatgaacagggtattgcattagaatcaatagtaagagttgag
ggtacagttataccaagaccggcagcaactataaatcctaaaatgactacgggccatgtt
gagattgaggctgaaaaaattgaaatacttaatccggctaagagaaatttaccctttgat
gtacgtaaattcaatagagctggtgaacgtttgcgtttgacacatcgttatatagactta
agatttgccgatatgcagcataatttacgtatgcgctctcaagttattatgcgcatgcgt
gaatatcttataaactatttgggttttgttgaggtagaaacacccacacttttccgccgc
acaccgggtggtgctcaagaatttgtggtgcctacacgtaaaccaggtcatttctattca
ctagttcagagtcctcaacaatttaaacaaatgttaatggctggtgccatagatcgttat
ttccaagttgctcgctgttatagagatgaggctacacgtcccgatcgtcagcctgaattt
actcaactcgatattgaattgtcatttaccagtcgcgatgatataatgcaattgattgag
gaaactttacgttattcttggcccaaggaatatactaaaattcagacacccttcaaacgt
atgacctataatgaggccatggagaaatttggtaccgataagccagatacacgttttagt
cttgctttgacaaatgtaaccgaaattattaaaaagaatgaaacatttgttgagaaattt
aaagatttaggtgcttatgctttaatagtacgtggcaatggaggtttctggaatggcact
gctcgtaaacattatgaaagtctttccaaagaattttcgggcaccttgtttgtacgcaag
tttttgcaatataaagatcttaaggatcgtttaactaatctattaacggctgatgttgcc
tcggaattaattaccaaatatgatttagaagaaaatgatttgctatttttgggtattggt
gaaaaagttgaaacgcaaaaacttttgggtaaaattcgtgtggactatcacaactttttg
attgaaaatggccgagctcgtaaaaattacgataataaatttgtatggatcattgatttt
ccaatgtttgaacttaatcctgaaactggtaatttggagagtgttcatcatccatttacg
gccccgcatcctgatgatatggaagatttcataaattctaaatcagaggatttagtaaat
atacgttcacaagcgtatgatttggtattgaatggccaggaggttggtggtggttcgata
cgtatacatgatcgtgatatgcaacattttgttttggaacaaattttaaaaattccccac
gatcatttggcacatttactgaatgccttggaatctggttgtccaccacatggtggtata
gccttgggcttagatcgtttaatggccatcatatgccgagcagtatcgatacgtgatgta
atagcattccctaaatcactcaatggtcgtgatccattgtccagtgcgcctgtaccgata
tctgaagaggaaaaagctctatatcatttgtcaattcttgagggtaatggtggtggtgag
gaagaagcccatggccaggaagatactgatccagatgcagtacgcgcctcgccttcccct
tcggctatggatgaagatcaggcggctgtaaatgaagaagaagaaatgccagtcgatgag
gaaccaccagccgctgttgaagttaaaactgagaaaaaaagcccgcaaaaagaagaaacc
gttaaacctaaacgtgctgctaagaagaagcaataa

DBGET integrated database retrieval system