KEGG   Lucilia cuprina (Australian sheep blowfly): 111684621Help
Entry
111684621         CDS       T06013                                 

Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Pathway
lcq00600  Sphingolipid metabolism
lcq01100  Metabolic pathways
Module
lcq_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    111684621
Enzymes [BR:lcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     111684621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 111684621
NCBI-ProteinID: XP_023302599
Position
Unknown
AA seq 636 aa AA seqDB search
MQRISVKIENDSEKSDVCSISNELRDTFYSNSKKGNVFHVRLNSNGLLLQRDTSSGGHKD
HLVNICDIIGGRCVWIQKSASFGAAGTCGSCTPNITEKHKNRDENEDAYLYVFAYILKKN
LRNAVRRERTVITLRFRSFDSHEDNMREAEKWYKTLKSHRNNHLLLSNLRGKELCGKTAK
SIETKRLLILLNPKSGSGKARQLFNHQVVPILNEAEIPYDLHVTKHSNYAFDFVRQKNLS
IWSGIVAIGGDGLFHEILNGLLKRSDWIEIVNTLALGIVPCGSGNGLARSIAHCYQEPYE
PKPIIGAALSLVGCQSSLMDVVEIEMNNKIAYSFLSIGWGLISDIDIESERLRPLGYQRF
TIWTLHRLINLRTYRGRISYLPKICSSDQNTPETVSKISLQHSMSCNTLPPQCPLRKQSL
SNDGSVEFDDVISLETVANQSFRSRCNSLLSSGSRVSTYYSIAESIYHSISGNTDCCESN
QHEESQADYRGTRLGQLEEKMLPALQDPLPSTWIVEDGEFVMIHAVYQTHLGSDCFFSPH
SKLNDGTIYLVMIRGGISRSQLFNFLINMSSGTHLPNQNTEYILVERVVAFRLEPHDNSG
ILTVDGERMECGSLQARIFPGTINVMVPNKRAFKDC
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaatctcagtaaaaatcgaaaacgattctgagaaatccgatgtatgttcaatt
tcaaatgagctaagagatacattttactcaaacagtaagaagggtaatgtcttccacgta
cgcctcaactcaaatggattacttttgcaacgtgacacatcaagcggaggtcataaggat
catttagtaaatatttgcgatataataggtggacggtgtgtttggattcagaaatctgct
agtttcggagcagctggtacatgtggatcgtgtacaccaaatatcacagaaaagcataaa
aatcgtgatgaaaatgaagatgcatacctttatgtctttgcctatattcttaaaaagaat
cttaggaatgctgtacgccgtgaacgcactgtcattactttacgatttcgttcattcgac
agccatgaggataacatgcgagaggctgagaaatggtacaagacactgaaatctcacaga
aacaatcatttgttacttagtaatctaagaggaaaagaattatgcgggaagacagcaaaa
tcaatagaaactaagcgtctacttattttgctgaatccaaaatcaggttccggaaaagca
cgtcagctatttaatcaccaagtggttcctattctcaatgaggcagaaattccatatgac
cttcatgttacgaaacattctaattatgcttttgactttgtacgtcagaaaaatttgtcc
atttggagtggtattgtagctattgggggcgatgggttatttcacgaaatcttaaatggc
ttacttaaacgaagcgattggattgaaattgtaaatactctggcgcttggtattgttccg
tgtggttcgggcaatgggttagcccgttcaatagctcattgttatcaggaaccatacgaa
ccaaaaccaataattggtgcagcattgtcgcttgttggctgccaatcatcgcttatggat
gttgttgaaatagaaatgaataataaaatcgcatattcatttctatctattggatggggt
ctaatttctgacatcgatatcgaaagcgaacgtttgcggccattaggatatcaaagattt
acaatttggacattacaccgtctgataaatttgcgtacatatcgtggtagaatatcatat
ttacctaaaatttgtagttctgatcaaaatactccagaaacagtatctaaaataagtctg
cagcacagtatgagttgcaacacacttccgccacaatgtcctttaagaaaacagtcttta
tcaaatgacggaagcgtagaatttgatgatgtaatatcattggaaacagtagcaaatcaa
tcttttcgttcacgatgtaatagtttactttcttcggggtcaagggtcagcacgtactat
tccattgccgaaagtatttatcatagtatatcgggtaatacggactgctgtgaatcaaat
caacatgaagaatcccaggccgattatcgtggaactcggcttggtcaattagaagagaaa
atgttgccggcactacaagatccattaccaagtacatggatagttgaggatggtgaattt
gttatgatccatgcagtttatcaaacacatttgggtagcgattgtttcttctcaccacat
tcaaaactaaacgatggtacaatttaccttgtaatgatacgaggtggcataagcagatcg
caattatttaattttctgattaacatgagctctggcactcatttacccaatcaaaataca
gagtatattctggtagaacgtgtagttgcctttcgtttagaaccacacgataatagtggt
attcttacagtagatggcgaacggatggaatgtggatcgttacaagcaagaatatttcca
ggaactatcaacgttatggttcccaacaaaagggcatttaaagattgctag

DBGET integrated database retrieval system