KEGG   Lucilia cuprina (Australian sheep blowfly): 111686711Help
Entry
111686711         CDS       T06013                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Pathway
lcq00450  Selenocompound metabolism
lcq00970  Aminoacyl-tRNA biosynthesis
lcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    111686711
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    111686711
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lcq01007]
    111686711
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lcq03016]
    111686711
Enzymes [BR:lcq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     111686711
Amino acid related enzymes [BR:lcq01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   111686711
Transfer RNA biogenesis [BR:lcq03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    111686711
 Prokaryotic type
   Other AARSs
    111686711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS GST_N_5 GST_C_3 tRNA-synt_1 GST_C_2 GST_C tRNA-synt_1e Anticodon_1 PDCD7
Motif
Other DBs
NCBI-GeneID: 111686711
NCBI-ProteinID: XP_023304852
Position
Unknown
AA seq 1016 aa AA seqDB search
MKIYTNEGNPLGLKLQILAKFAKREVSVEKVNLNDIKSKDLLVLPTLELENGLRLFSTDA
VAKYLFPNEGQLRDEWLEWSSTLLAPALVHHMGHGHRANPNALPVLNALVKKLEDNLSKT
PFLAGDKLTAADLSVWSLLAPDGTLKGAQQIEHLLVWYRKISAMPEIKSVLQTQPLKDLT
FNALQNSNLYGGLYHVPLKMPASLSEAGNLLADTGSTLADTITDEELNLASTNFVYVPMA
ERKEPRTVLPKAGERNVLVTSALPYVNNVPHLGNIIGCVLSADIFARYSRAAGYNTLYIS
GTDEYGTATENKALAENLTPREICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTEIVQEA
FKDVYDNGYILTESVEQLLCQKCDRFLADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNA
TDLIRPRCKVCNTAPVVRSSDQLFLDLPKIENKLREWVDHSENGWTNNARVITRAWLREG
LKPRCITRDLKWGIPVPHKGFENKVFYVWFDAPFGYVSMTKRYSKEFKQWWQPEKGVDVE
LFQFMAKDNVPFHSVVWPSALLAINKGNTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDA
QDTGIPADVWRFYLASARPEGQDSSFSWNDLAARNNSELLNNLGNFVNRALVFCEKNFNG
VVPAMNLTNDEHVLLALINRELRGYVNSLEKARLRDGIRHMLSISRHGNGYMQAQQPWVL
LKGNDQQKSRAATIIGLCCNIACLLANLIFPYMPTTARTMFEQLNAKQSQLNVEKPFTSI
LLPSGHKIGKPAPLFAKLEQSFIDEMKKKYAGPQVLGSSDAQTSSANIADLEKAIQEQGD
KVRQLKASTKDKAVWQPEVNKLLDLKKQLTEAQSKQSAETKQNGAAPKSVKDLEAAIQAQ
GDKVRQLKASTKDKAVWQPEVNKLLDLKKQLAEAQASITSAATTTTSSPASVDPKKVKEV
EEKIAKQAEKVRTLKASADASVWKPEVEILLALKKELTTLTGAPEPNAQGKNKKKK
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctatacaaacgagggcaatccccttggcctgaaattacaaatcttggccaaa
tttgcaaaacgtgaggtgtctgtggaaaaagttaacctaaatgatattaaatctaaagac
ttattggttttaccaactttagaattggaaaatggtctaagactattttcgacagatgcg
gtggctaaatatttatttcccaatgagggacaattaagggatgagtggcttgaatggtct
tctactttattggctcctgcgttggtacatcacatgggtcatggccatcgtgctaatcca
aatgctcttcccgtacttaatgccttggttaagaagctagaagataatttatccaaaact
ccatttttagctggtgataaattgacagcagctgatctttcagtttggtctttgctggca
cccgatggcacattgaaaggagctcagcaaattgaacatcttctcgtgtggtatcgtaaa
attagcgccatgcctgaaattaaatcagtattgcaaacacaaccattaaaagatttaact
tttaatgctttacaaaattctaatctttacggaggtctctatcatgttcctctcaaaatg
cctgcatcattatccgaagctggcaatctattggctgatactggttctacattggctgat
accattactgacgaagaacttaacttggccagtacaaactttgtatatgttcccatggca
gagcgtaaggaaccacgtacagttcttccgaaagctggtgagcgtaatgtgctggtcacc
tctgctctcccctatgtcaataatgtaccacatttgggcaacattattggctgtgtatta
tccgctgatatttttgcaagatactcacgtgcagctggctacaacactctctatatatcg
ggtactgatgagtatggtacagctaccgaaaacaaagcacttgctgaaaatcttacgcct
cgtgaaatttgtgacaaatactttgaactacacaatgcgatttatcgttggtttggcatt
ggtttcgattactttggtcgcaccacaacccaagaacaaacagaaattgtacaagaagcc
tttaaagatgtctacgataatggttatatcttaactgaaagtgttgaacagttattgtgc
cagaagtgtgatcgtttcttggccgatcgttttgttgagggtacttgtccccatcctgga
tgtggctacgaggacgctcgtggtgatcaatgtgacaaatgtggcaagctggttaatgct
accgatcttatacgtccccgctgtaaagtgtgcaacacagcaccagttgtcagatcctcc
gaccaattgttccttgacttaccgaaaatcgaaaacaaactgcgtgaatgggttgatcat
tctgaaaatggttggacgaataatgctcgtgttataacacgtgcttggttacgtgagggc
ttgaagcctcgttgtattacacgtgatctgaaatggggtattcccgttcctcacaaaggt
tttgaaaacaaagtattttatgtttggttcgatgcaccattcggctatgtttctatgacc
aaacgttactccaaggaattcaaacaatggtggcaacccgaaaagggtgtggacgttgaa
ctcttccaatttatggctaaagataatgtacccttccattcggttgtttggcctagtgct
ttgttggctatcaacaagggcaacactttggtatctcacatcatggcaactgagtatttg
aattatgaagacggcaaattcagtaaaagtcgtggtattggtgtcttcggtaacgatgct
caggacactggtattcccgctgatgtttggcgtttctatttggcttcagcccgtccagaa
ggtcaggattctagcttcagttggaatgatttggcagcccgtaataattctgagttactt
aacaatttgggcaactttgtaaatcgtgccttagtcttctgtgaaaagaactttaatggt
gttgtacccgccatgaatcttaccaatgacgagcatgttttgctggctctaattaatcgt
gagttacgcggttatgtcaactccttggagaaagcccgcttacgtgatggcatcagacac
atgctttcgatctctcgtcacggcaacggttacatgcaagcacaacaaccctgggtttta
cttaagggtaacgatcaacaaaagtctagagctgctacaattattggtttgtgctgtaat
attgcttgccttttggccaatcttatcttcccctatatgccaacaacggcaaggactatg
ttcgagcaattgaatgctaagcagtcacaattgaatgttgaaaaaccatttacctcaatt
ttgttgccatccggccataagattggcaaaccagcaccactgttcgctaaattggaacaa
agtttcattgacgaaatgaaaaagaagtatgctggtcctcaggtcttaggttcctccgat
gcacagaccagctctgcaaacattgctgatttggaaaaggctatacaggagcaaggtgat
aaagttagacaacttaaagcgtccacaaaagataaagcggtatggcaaccagaagtaaat
aaacttttagatttgaagaaacaactaaccgaggctcaaagtaagcagtcagcagaaact
aaacaaaatggtgctgcacccaaaagtgtaaaagatcttgaagctgccatacaggcacag
ggtgataaagtacgtcaactgaaagcgtccacaaaagacaaagctgtttggcaacccgaa
gttaataagcttttagatttgaaaaagcaattagctgaagctcaagcctctatcacttct
gctgctacaaccaccacttcatcacctgcctcggttgatcccaaaaaggtaaaggaagta
gaagagaagattgccaaacaagctgaaaaagtacgcactttaaaagcttctgctgatgct
tccgtttggaagccagaagttgagattcttttggctcttaaaaaggaattaaccacttta
actggtgctcccgaacccaatgctcagggcaaaaataaaaagaagaagtaa

DBGET integrated database retrieval system