KEGG   Lucilia cuprina (Australian sheep blowfly): 111687156Help
Entry
111687156         CDS       T06013                                 

Definition
(RefSeq) heat shock protein 70-like
Organism
lcq  Lucilia cuprina (Australian sheep blowfly)
Pathway
lcq03040  Spliceosome
lcq04141  Protein processing in endoplasmic reticulum
lcq04144  Endocytosis
lcq04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:lcq00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111687156
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111687156
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111687156
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    111687156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70
Motif
Other DBs
NCBI-GeneID: 111687156
NCBI-ProteinID: XP_023305342
Position
Unknown
AA seq 176 aa AA seqDB search
MVAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP
KNTVFDAKRLIGRKYDDPKIMEDIKHWPFKVISDGGKPKIGVEFKGEHKKFAPEEISSMV
LTKMKETAEAYLGQTVTDAVITVPAYFNDSQRQATKDAGRIAGLNVLRIIXNSQIA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcaattggtattgatttgggtacaacatattcctgtgttggtgtcttccaacat
ggaaaagttgagattattgccaacgatcaaggcaaccgaacaacacccagttatgttgcc
ttcacagacacagaacgtctcattggtgatgcggcgaagaatcaagttgccatgaatccc
aagaacacagtatttgatgcaaaacgtcttattggtcgcaaatatgatgatcccaagata
atggaagatattaaacactggccattcaaagtgatcagtgatggtggcaaaccgaaaatc
ggtgtcgaattcaagggtgaacataagaaattcgcaccagaggaaatcagttcaatggtg
ttgacaaagatgaaggaaactgcggaagcctatttgggtcagacagtaaccgatgcagta
attacagttcctgcctactttaacgattcacagagacaagccaccaaagatgctggtcgt
attgctggtttaaatgtattgagaattatcanaaattctcaaatcgcatag

DBGET integrated database retrieval system