KEGG   Lactobacillus crispatus: LCRIS_00303Help
Entry
LCRIS_00303       CDS       T01222                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lcr  Lactobacillus crispatus
Pathway
lcr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lcr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LCRIS_00303 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lcr03011]
    LCRIS_00303 (rplV)
Ribosome [BR:lcr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LCRIS_00303 (rplV)
  Bacteria
    LCRIS_00303 (rplV)
  Archaea
    LCRIS_00303 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CBL49750
UniProt: D5H165
Position
319717..320070
Genome map
AA seq 117 aa AA seqDB search
MAEQISSAKAEARTVRIAPRKARLVVDLIRGKSVAEALAILEFTPRAASPIVEKVLRSAI
ANAEHNYDLESANLYVSEAYVNEGATLKRFRPRAKGMASPINKRTSHVVVVVSEKND
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacaaattagttcagctaaggctgaagcaagaactgttcgcatcgctccaaga
aaagctcgtttagtcgttgacttaattcgtggcaagagcgttgctgaagcattagcaatc
ttggaatttacgcctagagctgcttccccaatcgttgaaaaagttttgcgttcagctatt
gctaacgcagaacataactacgatcttgaaagtgcaaacctttacgtatcagaagcttat
gtaaatgaaggtgcaactttgaagagattccgcccacgtgctaagggtatggcttctcca
attaacaagagaaccagtcacgtagttgtagtagtttcagaaaagaacgattaa

DBGET integrated database retrieval system