KEGG   Lactobacillus crispatus: LCRIS_00435Help
Entry
LCRIS_00435       CDS       T01222                                 

Definition
(GenBank) HAD superfamily hydrolase, subfamily IIA
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
lcr  Lactobacillus crispatus
Pathway
lcr00627  Aminobenzoate degradation
lcr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lcr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LCRIS_00435
Enzymes [BR:lcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     LCRIS_00435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2
Motif
Other DBs
NCBI-ProteinID: CBL49882
UniProt: D5H1J7
Position
424339..425109
Genome map
AA seq 256 aa AA seqDB search
MKDYRVFLIDLDGTVYRGKETVESGVRFVHRLVQAGKDYLFLTNNTTRTPQMVVDKLKGH
GIETDTDHVYTPSMATASYILQREHKEKIGLYIIGQIGLWRELLQHPEFEINEENPDYVI
VGMDTDLTYHKVRVASRAIRRGATFIGTNADMNLPAEDELIPGNGSQCAFVAAASGVEPL
YIGKPESIIVKMALDKVGYSKDEALLVGDNYDTDIKAGFNSGVDQLLTLTGVTTKVDIAD
KRQPTILVNNLDEFEL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagattaccgggtatttttaattgacttagacggaactgtttatcgtggtaaggaa
acagttgaatcaggagtaagatttgttcatcgtttagttcaagcagggaaagactatttg
tttttaaccaacaatacgaccagaacaccgcaaatggtagttgataaactaaagggacac
ggtatcgaaactgatacggaccatgtttatacgccaagtatggccacagctagctatatt
ttacaaagagaacacaaggaaaagatcggcttgtatattattgggcagattggtctctgg
cgtgaattattgcaacatccagagtttgaaattaatgaagaaaatcccgattatgtaatt
gtcggtatggatacagatctgacttatcataaagtacgagtagcttcacgggcgattaga
cgtggagccacttttattgggactaatgccgatatgaatttaccagcagaggatgagcta
attccaggcaatggttcacaatgtgcattcgttgctgcagcaagtggagtagagccactg
tatattggtaagcctgaatcaattattgtaaaaatggctttggataaagttggctatagc
aaagatgaggcacttttggtaggtgataattacgataccgatattaaagctggctttaat
agtggagtagatcagttgttgactttgacaggtgtgacgaccaaagtggatattgcagat
aaacgtcaaccaacaattttagttaataacctagatgaatttgaattatga

DBGET integrated database retrieval system