KEGG   Lactobacillus crispatus: LCRIS_00630Help
Entry
LCRIS_00630       CDS       T01222                                 

Gene name
atoB
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lcr  Lactobacillus crispatus
Pathway
lcr00650  Butanoate metabolism
lcr00900  Terpenoid backbone biosynthesis
lcr01100  Metabolic pathways
lcr01110  Biosynthesis of secondary metabolites
lcr01120  Microbial metabolism in diverse environments
lcr01130  Biosynthesis of antibiotics
lcr01200  Carbon metabolism
lcr01212  Fatty acid metabolism
lcr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LCRIS_00630 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    LCRIS_00630 (atoB)
   00640 Propanoate metabolism
    LCRIS_00630 (atoB)
   00650 Butanoate metabolism
    LCRIS_00630 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LCRIS_00630 (atoB)
   00072 Synthesis and degradation of ketone bodies
    LCRIS_00630 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LCRIS_00630 (atoB)
   00310 Lysine degradation
    LCRIS_00630 (atoB)
   00380 Tryptophan metabolism
    LCRIS_00630 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LCRIS_00630 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LCRIS_00630 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LCRIS_00630 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcr04147]
    LCRIS_00630 (atoB)
Enzymes [BR:lcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LCRIS_00630 (atoB)
Exosome [BR:lcr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LCRIS_00630 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBL50077
UniProt: D5H242
Position
633509..634672
Genome map
AA seq 387 aa AA seqDB search
MKDIYIVAAKRTPFGKYRGFFKDASAIDLGVMALKGTMKAGNIKPADVQALFMGNVLDTG
LGENMARQVALHSGMSEASAAVTINEVCGSSLKALRLAQGQMELGDLDLVAVGGSESMTN
APYFVKKENKNDPADHLVSTMLNDGLMDAFSGKHMGITAENVAEKYHVSRQDMDEFALQS
HQKAAAAVKSGFFDNEILDVEIDGQSLDHDEPIRPDTTLEALSNLKPVFKADGEVTAGNS
SPLTDGASMLVLATKEKMKELGLTPIAKLGEFAEAGFDPALMGYTPYYAVKKLLKKTGRN
FDDYDIIELNEAFAAQSVAVARDLQIPTDKLNIMGGAIALGHPLGATGTRLVASAISGLK
KRKGRRALVTLCIGGGQAIAYEIENAE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacatttatattgttgcagctaaaagaacaccttttggcaagtaccgaggattt
tttaaggatgcttctgcaattgatttgggtgtaatggccttgaaaggaacaatgaaggcg
ggcaatattaagccagctgatgttcaagcactgtttatggggaatgttttggataccggc
ttaggtgagaatatggctcgccaagttgccttacattcagggatgagtgaagcttctgca
gccgttacaattaatgaagtctgcggctcaagtctgaaagctttacgtctagctcaagga
cagatggaactaggcgatttggatctagtagctgtcggcggtagtgagagcatgactaat
gcgccttattttgttaaaaaagaaaacaaaaatgatccagcagatcacctagtaagtact
atgcttaacgatggtttgatggatgctttttctggcaagcatatgggaattactgccgaa
aacgtagcagaaaaatatcatgttagtcgtcaggatatggatgaatttgcattgcagtcg
catcaaaaggcagctgcagcagttaaatccggattttttgataatgagatcctggatgtg
gagattgatggtcaaagtttagatcatgatgaaccaattcgtccggatacaacgcttgag
gcattgagtaacttaaagcctgtttttaaggcggatggtgaagtgactgccggaaactcg
tctcctttgactgatggtgcaagtatgttagttctggcaactaaggagaaaatgaaagag
ttaggcttaacgccaattgccaagttaggtgaatttgcggaagctggctttgatcctgca
ctgatgggttatactccatattatgcggttaaaaaactgcttaagaagacgggacgtaat
tttgatgactatgatattatcgaactaaatgaagcctttgcagcccaaagtgtagcggta
gctcgcgacttacaaattccaactgataaattgaatattatgggtggcgcaatcgcgtta
ggtcatcctttaggtgcaacgggtacacgcttagtcgctagtgcaattagtggattaaag
aagagaaaaggcagacgtgccctggttactttgtgtattggtggcggtcaggcgattgct
tatgaaatcgagaatgcagaatga

DBGET integrated database retrieval system