KEGG   Lactobacillus crispatus: LCRIS_01338Help
Entry
LCRIS_01338       CDS       T01222                                 

Gene name
ispA
Definition
(GenBank) Geranyltranstransferase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
lcr  Lactobacillus crispatus
Pathway
lcr00900  Terpenoid backbone biosynthesis
lcr01100  Metabolic pathways
lcr01110  Biosynthesis of secondary metabolites
lcr01130  Biosynthesis of antibiotics
Module
lcr_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:lcr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LCRIS_01338 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:lcr01006]
    LCRIS_01338 (ispA)
Enzymes [BR:lcr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     LCRIS_01338 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     LCRIS_01338 (ispA)
    2.5.1.29  geranylgeranyl diphosphate synthase
     LCRIS_01338 (ispA)
Prenyltransferases [BR:lcr01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   LCRIS_01338 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: CBL50785
UniProt: D5GYC6
Position
complement(1347414..1348283)
Genome map
AA seq 289 aa AA seqDB search
MTAFTYFKDEWTPVIDDYLAKHLASEVEDQKISQIMAYSVMAGGKRLRPLLFLATLNALG
RKIEEPEIRIACGIELIHTYSLIHDDLPAMDNDDYRRGKLTSHKKWGEAEAILAGDALLP
MGIQWIAEGSKSAKLVDLITKAVGPNGMVGGQYLDIDSTNNASVAGDAKFINKMEWLKTG
CLIQASVEMAAVYAGASDIEQVKLVDFAKIFGRSYQIYDDLVDVVETSAEAGKATHKDQA
EGKNNTLTLLGIDQSRKELTDLIKQAQDDLHGLKGEVLAGFLDLYQKVL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgacagcatttacttattttaaagatgaatggaccccagtaattgatgattatctggct
aagcatttggctagtgaggttgaagatcaaaagatcagtcagattatggcctactcggtg
atggctggcggcaagcgcttgcgtccgttattgtttttagctacgttaaatgctttaggc
agaaagattgaagaacctgaaattaggattgcctgcgggattgaactgattcacacttat
tccttgattcatgatgacctgcctgccatggataacgatgactatcggcgcggtaagctg
actagccacaaaaaatggggtgaggctgaggcaattttagctggggatgcgctcttgccg
atgggaattcaatggattgcggaaggcagtaagtcggcgaaattggtagatttaattacc
aaagcagttggccctaatgggatggttggcggtcaatatttggatattgattcaactaac
aatgctagtgttgcgggtgatgccaagtttatcaataagatggaatggctgaagaccggt
tgcttaattcaggctagcgttgagatggctgcagtttatgcaggagctagtgatattgaa
caggtaaaattagtcgattttgccaaaatttttggtcgttcataccaaatctatgacgac
ttggttgatgtcgttgaaactagtgcagaagctggtaaggcaacccacaaagatcaagct
gaaggtaaaaacaatactttgactttattgggaattgaccaaagccgcaaagaattaact
gatttgatcaagcaggcacaagatgatttgcatgggctcaaaggcgaagtacttgctggc
ttcttagatctttatcaaaaggtgttataa

DBGET integrated database retrieval system