KEGG   Lignipirellula cremea: Pla8534_62090
Entry
Pla8534_62090     CDS       T06949                                 

Gene name
hcrA
Definition
(GenBank) 4-hydroxybenzoyl-CoA reductase subunit alpha
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
lcre  Lignipirellula cremea
Pathway
lcre00230  Purine metabolism
lcre01100  Metabolic pathways
lcre01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lcre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Pla8534_62090 (hcrA)
Enzymes [BR:lcre01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Pla8534_62090 (hcrA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: QDU98342
UniProt: A0A518E2P5
Position
complement(8303449..8305734)
AA seq 761 aa
MATADKPKYNVIGTRPVRHDGVDKVTGRAKYGADIRLTGMLHGAMLRSPHAHAKILSIDT
SAAEALPGVRAVVTGADFPEQGDRIVELGEGAANMRHLSANVMARDKVLYKGHALAAVAA
DNIHIASEAVRLIKVEYEKLPPVLDVRKAMQADAPVLNDDIRTESVGSAPATKDSRPTNI
AKHFLFEKGDAAAGFAAADLVIEREFDTTMVHQGYIEPHNATVLWNADGKISIWISTQGS
FSVRQQTAELLKVPVSSVKVTPMEIGGGFGGKISVYLPPVAAVLSRKTGRPVKIVMSRAD
VFEATGPTPGSHMKVKLGVTKDGKITAGEAWIAFEAGAYTGSPIGPACMCVFACYDVPAG
RVEGFDVCVNKPRTNAYRAPGSTQVAFATESVVDEICVELKMDPAEFRLKNGAKEGVRRI
DGPKYARIGMLETVEAIQASEHYNSPLEGKYRGRGIATGFWFNVGMQSSVTATVNYDGVV
SLVEGSTDIGGTRTSIAMQLAETLGIAAEAVNPVVVDTDSVGYTDVTGGSRVTFATGIAA
VEAAKEIQWQLVDRAAFLWNVDPEKVRYENGGVVGPGDKRMSFQELAGKLHASGGTVTGT
GVSSKANQAGAFGTHCVDVEVDPELGKVQILRYTVAQDAGTAIHPSYVEGQMQGGAVQGI
GWALNEEYYYGDDGDMKNATYLDYRMPTCYDVPMIETIIVEVPDPQHPYGVRGVGEVPIC
PPPAAIANAIFQATGVRMRRLPMSPSRLLPEILKASSKSSK
NT seq 2286 nt   +upstreamnt  +downstreamnt
atggcgaccgcagacaagcccaaatacaacgtgatcggcacgcggcccgtgcgccacgac
ggcgtcgacaaagtcactggccgggccaaatacggcgccgatatcaggctcaccggcatg
ctccacggcgccatgctgcgcagcccgcacgcccatgcgaagatcctcagcattgatact
tcggcggccgaagcgctgccgggcgtgcgcgccgttgtcaccggggccgactttccggaa
cagggcgaccgcattgtggaactgggcgaaggcgccgccaacatgcggcacctgagtgcg
aacgtgatggcccgtgacaaggtgctgtacaaaggccacgccctggccgcggtcgccgcc
gacaacattcatatcgccagcgaagccgttcgcctgatcaaggtcgagtacgaaaaactg
ccgcccgtgctggatgtgcggaaagcgatgcaagccgacgcgcccgtgttgaacgacgac
atccgtacggagtcggtcggttcggccccggcgacgaaggactctcgcccgaccaatatc
gccaagcacttcctgtttgaaaaaggggacgccgcggccggctttgccgccgccgatctg
gtcatcgaacgggagttcgatacgacgatggtgcaccagggttacatcgaaccgcacaac
gccacggtgctgtggaacgccgacggcaaaatcagtatctggatcagcacgcaaggttcc
ttttccgtgcggcagcaaacggccgaactgctgaaggtgcccgtctccagcgtcaaagtg
acgccgatggaaatcggcggcggctttggcggcaagatctccgtctatctgcccccggtc
gcggccgtgttgtcgcgcaagactggccgtccggtcaaaatcgtcatgtcccgggccgat
gtgttcgaagcgaccggccccacgcccggctcgcatatgaaggtcaagctgggcgtcacc
aaagacggcaagatcaccgcgggggaagcctggatcgcctttgaggcgggagcctatacg
gggtcgccgatcgggccggcctgcatgtgcgtgtttgcctgttacgatgttcccgccggt
cgggtcgaaggcttcgatgtctgcgtgaacaagccacggacgaacgcctatcgggcgccc
ggttccacgcaggtcgcctttgcgacggaatccgtcgtcgatgaaatctgtgtcgagctg
aagatggacccggccgagttccgcctgaagaacggcgccaaagaaggcgtgcggcggatc
gacggacccaagtacgcccgcatcggcatgttggaaacggtcgaggcgatccaggccagc
gagcattacaactcgcctttggagggaaagtatcgcggccgcggcatcgccaccggtttc
tggttcaatgtggggatgcagtcgtcggtcacggcgacggtcaactacgacggcgtggtc
tcgctggtcgagggctcgaccgatatcggcggcacccgcaccagcatcgccatgcaactg
gcggaaacgcttggcattgcggccgaagcggtcaacccggtcgtggtcgataccgacagc
gtcggctataccgatgtcacgggcggcagccgggtgacgttcgccaccggcatcgccgcg
gtggaagcggccaaagagatccagtggcaactggtcgatcgagccgcctttttgtggaac
gtcgaccctgaaaaagtccgctacgagaacggcggcgtcgtcggcccgggcgacaagcga
atgtccttccaggaactggccggcaaactgcacgcttccggcggcacggtgaccgggaca
ggcgtatccagcaaagcgaaccaggctggcgcctttggcacgcactgcgtcgatgtcgaa
gtcgacccggaactgggcaaggtgcagatcctgcgctacacggtcgcccaggatgcgggc
acggcgatccatcccagctatgtcgaaggccagatgcaaggcggcgccgtgcagggaatc
ggctgggccctcaacgaggagtactactacggcgacgacggcgacatgaaaaacgccacc
tatctcgattaccgcatgccgacctgttacgacgtgccgatgatcgaaacgatcattgtc
gaggtgcccgacccgcagcatccttacggcgtccgcggcgtcggcgaagtgccgatctgt
ccgcccccggccgccatcgccaacgccattttccaggcgaccggcgtccgcatgcggcgc
ctgcccatgtcgccttcacgattgctgccggagatcctcaaagccagctcaaaaagcagc
aagtaa

DBGET integrated database retrieval system