KEGG   Lactobacillus casei BD-II: LCBD_0419Help
Entry
LCBD_0419         CDS       T01955                                 

Gene name
mtlD
Definition
(GenBank) Mannitol-1-phosphate dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
lcs  Lactobacillus casei BD-II
Pathway
lcs00051  Fructose and mannose metabolism
lcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LCBD_0419 (mtlD)
Enzymes [BR:lcs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     LCBD_0419 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh
Motif
Other DBs
NCBI-ProteinID: AEA55918
UniProt: A0A125U644
Position
411538..412623
Genome map
AA seq 361 aa AA seqDB search
MLDVDDSIISSINAIGGYDLYLINHNYQKVFIDQVSAINSLKDTQGAIDAIKDADIITTA
VLATNLEKIAPILSKGLKARLQLRKAKINILACENLENNSGVLRKKVLALGEIKENDLES
IAAFPDTEVDRLVLKSERNGEPAIDIGDEFELVVDKTKLVNPGVEPIKNAFYTTDIHKYF
ERKLFIINTGHCWAGYVGHVYGYKVIQDVFANKPLLRATREAMKESAVLIEKKYGFSKDD
LDDYISFALNRFMTPGVVDQIARVSRNPIQKIGPQERLVQPVQQLADRNLPYQQLVKGIS
AALLFDLDTDQQAIELQHYIEKNGVKQTIVHFTGIAEESVLFSQIMEHYNRFKQIKEKRT
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgttgatgacagcattattagtagcattaatgctatcggaggatacgatctg
tatctcattaatcataattatcaaaaggtttttattgatcaggtgagcgcgattaatagt
ctgaaggatacgcaaggtgcgattgatgctattaaggacgctgatatcatcacaacagca
gtattggcaactaatttggaaaagattgcccccatactatctaaaggcctaaaggcgcgg
ttgcagcttagaaaggccaaaataaatattttagcttgtgaaaatctagaaaacaactca
ggggtcctacgaaagaaggtattggcactcggagaaataaaggaaaacgatttagagtca
attgccgcatttcccgataccgaagtggatcgtttagtcctcaaatctgagaggaatgga
gagccggctattgatattggcgatgagtttgaacttgtggttgataaaacaaagttggtc
aatccgggggttgaaccaattaaaaatgctttttacacgacagatatccacaaatatttt
gaacgaaaactcttcatcatcaatactggccattgctgggctggatatgttggtcatgta
tacggatataaagttattcaagatgtttttgcaaacaagccgttgctacgcgcaacgcga
gaagccatgaaagaaagtgcggtactaattgagaaaaagtatggtttttcaaaagatgat
ctagatgactatatctcatttgcactcaatcgttttatgacgccgggcgtggttgaccaa
attgccagagtatcacgtaatccaattcagaaaattggccctcaggagcggttagttcaa
cctgtccagcaactagcagatcgcaacttgccttatcaacaactagttaaaggaattagc
gcggcactgctgtttgaccttgatacagatcaacaagccatcgagctacaacattatatt
gagaaaaatggagtaaaacaaaccattgtccactttacagggattgctgaagaatctgta
ctcttttctcaaatcatggagcattacaaccggtttaagcaaataaaagaaaaacgaacg
aactga

DBGET integrated database retrieval system