KEGG   Lactobacillus casei BD-II: LCBD_0429Help
Entry
LCBD_0429         CDS       T01955                                 

Definition
(GenBank) PTS family mannose porter, IIAB component
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
lcs  Lactobacillus casei BD-II
Pathway
lcs00051  Fructose and mannose metabolism
lcs01100  Metabolic pathways
lcs02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LCBD_0429
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    LCBD_0429
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lcs02000]
    LCBD_0429
Enzymes [BR:lcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     LCBD_0429
Transporters [BR:lcs02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    LCBD_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: AEA55928
UniProt: A0A454XJH1
Position
420262..420756
Genome map
AA seq 164 aa AA seqDB search
MIITLARVDDRLIHGQVTTVWSKESNADRIIIVSSEVYKDDIRKTLLKQAAPPGMKVNIV
DVPKAIAVYNNPKYQNEKVFYLFTNPREVVDLVKGGIPLEKLNIGGMQFKQGKTQISKAV
SLDADDVAAFRELHQLGVKLDLRVVKTDPSSDILAKIDEVFGKE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgattatcacacttgcgcgagttgacgatcggttaattcatgggcaagttacaacagtt
tggtccaaagaatcgaacgcagatcgcattattattgtcagttcggaagtttataaagat
gatattcggaaaaccttgttaaagcaggcagctcctcctggcatgaaagtcaatattgtt
gatgtaccaaaagcaattgccgtttataacaatcctaagtaccagaatgagaaggtgttt
tatctatttacaaacccacgtgaagttgtggacttagtaaaaggtggcattcctctagaa
aaattgaatattggtggtatgcagtttaagcagggaaaaactcaaattagtaaagcggtc
tctctggatgcagacgatgttgcagcatttcgggaattgcaccaattaggcgtaaaactc
gatcttcgtgtcgttaagacagacccgtcgtcagatatcttagcaaaaatcgatgaagtt
tttggaaaggaatag

DBGET integrated database retrieval system