KEGG   Lactobacillus casei BD-II: LCBD_1522Help
Entry
LCBD_1522         CDS       T01955                                 

Definition
(GenBank) Pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
lcs  Lactobacillus casei BD-II
Pathway
lcs00020  Citrate cycle (TCA cycle)
lcs00620  Pyruvate metabolism
lcs01100  Metabolic pathways
lcs01120  Microbial metabolism in diverse environments
lcs01200  Carbon metabolism
lcs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LCBD_1522
   00620 Pyruvate metabolism
    LCBD_1522
Enzymes [BR:lcs01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     LCBD_1522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 Dala_Dala_lig_C ATP-grasp ATP-grasp_3 HlyD_3 ATPgrasp_ST HlyD_D23 GCV_H RnfC_N RimK
Motif
Other DBs
NCBI-ProteinID: AEA57019
UniProt: A0A125U840
Position
1464596..1468033
Genome map
AA seq 1145 aa AA seqDB search
MHKVLVANRGEIAIRIFRACEELGLKTVGIFAKEDALSIHRFKAQESYQVGAGKAPIAAY
LDMDDIIRIAKQSGADAIHPGYGLLSENAEFARKVRAAGLIFVGPRSELLDIFGDKVAAK
EAAHKAGLATIPGTPEPTRDFSEIQDFTATHGFPVMLKAASGGGGKGMRIVHSEAELEAV
YQNAVNEAKASFGDDRMYVEKYIASAKHIEVQVLGDEHGHLLHLFERDCSVQRRQQKVVE
IAPAVALPTALRARICQSAVDLMQGLHYENAGTVEFLVDGDQYYFIEVNPRVQVEHTITE
LITDVDIVQSQLKIAAGADLFADLHLPKQADLHENGAAIQCRITTEDPENNFMPDTGTIN
TYRSPGGFGIRLDVGNAYAGAVVSPYFDSLLVKASVHAPNFTAAVAKMQRALHEFQITGV
KTNVAFLEHLLATETFRTGEAETAFIDAHPELLQVQAKPDTASRLLWYISDVTVNGFKGV
ERQAQKYYPELRYDVHFPAAKPQKDLVALLHADGAQGVTDWIKAQNQLLLTDTTFRDAHQ
SLFATRMRTRDMLTVAQDMGNGLPNLFSMEVWGGATFDVAYRFLNEDPWTRLKKLRAALP
HTLLQMLFRGSNAVGYQNYPDNVIKAFIQKAADDGVDVFRIFDSLNWLPQMTLSIDTVKQ
TGKLAEATMCYTGDILSHAHPKYQLAYYVDLAKQLVAAGADMLAIKDMAGLLKPQAATEL
VTALKDAVSVPIHLHTHDTTGNGIATYVAAANAGVDIVDVAQSSFSGTTSQPSLESLYYA
LSGNQRQPDVAIEKAQKLNRYFQAIRPYYADFSNGVTGPLTDIYTVQMPGGQYSNLQQQA
RSMGITDFEAVKTMYAEVNTLFGDIIKVTPSSKVVGDMALFMLQNHLTPDEVLAHGEQYD
FPASVVAFFKGDLGQPVGGFPKALQAKILKGQKPLTVRPGQLAKPADLKAVRAALVQAGM
NEPSTEDVLSAILYPDVFNAYARKQRQIGPVTKLDSPSYFQGMRIGETVSVPIKAGKTMI
IQLNAIGEADASGMKTLYFTVDGQKQEVQIRDAHQKSAGLRHQLAEPTDRNQIGAPMAGK
IVSVAVKSGQEVAQGDALFVIEAMKMETTVHAPFAGTVTHLYVEAGALIKSQELLAKLQP
GVTKQ
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagttttagtcgctaatcgtggcgaaatcgccattcggatttttcgtgcctgt
gaagagcttggtcttaaaacagtcggtatttttgctaaagaggacgctttgtcaattcat
cgattcaaagcgcaggaaagttatcaggtcggagcaggaaaagcgcctatcgctgcctat
ttggatatggacgatattatccgaattgccaagcaaagcggcgcggacgcgattcacccg
ggctatggcctgctttcagaaaatgctgagtttgcccggaaagttcgggcagccggcctc
atttttgttggcccgcgttcggaattactcgatatttttggcgataaagttgcggccaag
gaagctgctcacaaggcaggcttggcgactattcccggcacgccggaaccaacgcgcgat
tttagcgaaattcaggatttcacagccacacacggttttccggtgatgcttaaagcagca
tcaggcggcggcgggaaaggtatgcgaatcgttcactctgaagctgaacttgaggccgtg
tatcaaaatgcggtgaatgaagcgaaagctagttttggcgatgatcggatgtacgttgaa
aagtacattgcctccgccaaacatatcgaagtccaagttcttggcgatgagcatggccat
ttgttgcacctcttcgaacgtgattgttcagtacagcgccgccaacaaaaagtggttgaa
attgccccagctgtggcattgccaacagccttgcgggcgcgaatttgccaaagcgctgtt
gatttaatgcaaggcttgcactatgaaaatgccggtaccgttgaatttttggttgatggc
gaccagtactatttcattgaagttaatccgcgggtacaagtggaacacacgatcaccgaa
ctgattaccgatgtggatattgtgcagtcacagttaaagattgcagcaggcgccgatctt
tttgcagacttgcatttgccaaagcaggcagatttgcatgaaaatggcgcggcgatccag
tgccggattacgactgaggatcctgaaaacaatttcatgccagacacaggcaccattaat
acttatcggtcaccaggcggcttcgggatccgccttgatgttgggaatgcctatgctggg
gcagttgtcagtccttatttcgactccttattagtaaaggccagtgttcacgcaccgaat
ttcaccgctgccgtagccaaaatgcaacgcgctttacatgaatttcaaatcaccggcgtc
aaaaccaatgttgctttccttgagcacttattagcgacagaaactttccggacgggtgaa
gcagaaaccgcgtttattgatgcccatccagaactcttgcaagttcaggcaaagcccgac
acggcttcgcggttactgtggtacatcagtgatgtgacggttaatgggttcaaaggtgtt
gaacgacaggcacaaaaatattaccctgaattgcgctatgatgttcattttcctgctgcc
aagccgcaaaaagatttagttgccttgctgcatgctgacggtgcgcaaggggttactgat
tggattaaggcacaaaaccagttgctgttaacggacacgacttttcgtgatgcccatcaa
agtctttttgctacccggatgcgcactcgagacatgttgacggtcgcacaggatatgggc
aatggcttgccaaatcttttttccatggaagtatggggcggggcgacgttcgatgtcgct
tatcggtttttgaacgaggatccgtggacccgtttgaaaaaattgcgggcagccttgccg
cataccttgttacagatgttattccgtggcagtaacgcggtcggctatcaaaactatccg
gacaatgtgattaaagctttcattcaaaaagcagctgacgatggcgttgatgtttttcga
atttttgacagtttgaactggttgccacagatgacgctcagtattgataccgtcaaacaa
acaggcaagcttgctgaggcgacgatgtgttacacaggcgacattctaagtcatgcccac
cctaagtatcagctagcttattatgttgatctggccaaacaattagtggcagctggtgcc
gacatgcttgcgattaaagacatggccggcttgttgaaaccgcaagcggcgacagagtta
gtaacggcgctcaaagatgcggtcagtgtgccgattcatttgcacacacatgacaccact
ggtaacggtatcgcgacttatgtagccgctgctaatgctggggtcgatatcgttgatgtg
gcgcaaagcagtttttccggaacgaccagtcagcctagtctagaaagtctttactatgca
ttaagtggcaatcagcgacagccagatgttgccattgaaaaggcgcagaagttgaatcgc
tattttcaggcaatcaggccttactatgccgattttagtaatggtgtgacgggtccgcta
acggatatttatacagtccagatgccaggtggccagtatagtaacttgcagcaacaagcg
cgtagcatggggataacggattttgaggccgttaaaactatgtatgccgaggtaaatacc
ttatttggcgatatcatcaaagtaacgccatcctcaaaggtggtgggtgatatggcgttg
ttcatgctgcaaaatcacttgacacccgatgaagtgttggcgcatggtgagcaatatgat
tttccggcctcggtcgtggcattctttaaaggcgatctcgggcagccggttggtggtttt
ccgaaagcgctccaagcaaaaattctgaaaggacaaaaaccgttgacggtacgtccaggg
caattggcgaagccggctgacctgaaggctgttcgcgcggcgttagtacaagccgggatg
aatgaacccagcacagaagacgttttgagtgcaattctgtatccggatgtctttaatgca
tacgcccgcaagcaacggcagattggaccggtgacgaagttggattcgccatcgtatttc
caaggaatgcggataggcgaaaccgtgtctgtgccgattaaagcaggtaagacaatgatt
atccagctcaacgcgatcggcgaggcggatgcaagtggtatgaagacgctgtactttact
gttgatggtcaaaagcaggaagttcaaatccgcgatgcgcatcagaagagcgcggggttg
cggcatcagttggcggaaccgactgatcgtaatcaaattggtgcaccgatggcagggaaa
attgtttcagttgccgttaagtccggtcaagaagtggcacaaggggatgccttatttgtc
attgaagccatgaagatggagacgacggttcatgcgccatttgcaggtaccgtcactcat
ctttacgtggaggcaggcgccttaattaagagtcaggaactgctggccaagcttcaaccc
ggtgtgaccaagcagtga

DBGET integrated database retrieval system