KEGG   Lactobacillus casei BD-II: LCBD_1876Help
Entry
LCBD_1876         CDS       T01955                                 

Gene name
gnd
Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
lcs  Lactobacillus casei BD-II
Pathway
lcs00030  Pentose phosphate pathway
lcs00480  Glutathione metabolism
lcs01100  Metabolic pathways
lcs01110  Biosynthesis of secondary metabolites
lcs01120  Microbial metabolism in diverse environments
lcs01130  Biosynthesis of antibiotics
lcs01200  Carbon metabolism
Module
lcs_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LCBD_1876 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LCBD_1876 (gnd)
Enzymes [BR:lcs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     LCBD_1876 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     LCBD_1876 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 ApbA Shikimate_DH NAD_Gly3P_dh_N NAD_binding_11 F420_oxidored HMG_box_5
Motif
Other DBs
NCBI-ProteinID: AEA57372
UniProt: A0A125U939
Position
complement(1832750..1834168)
Genome map
AA seq 472 aa AA seqDB search
MDKPQIGVVGMAVMGKNLALNIESRGNTVAIFNRTGSKTKAVVEEHPDKKLVPSYKIEDF
VASLEKPRRIIMMVKAGAGTDAVIKELLPLLDKGDVLIDGGNTFFEDTMRRSAELDKSGI
NFIGMGVSGGELGALHGPSLMPGGQKEAYDLVAPILEAISAKAEDGAPCVTYIGPNGAGH
YVKMVHNGIEYGDMELIAESYNLMRNLLGLDVKEMADIFSEWNKGELDSYLIDITADILT
RKDDLGSDKPIVDMILDRAGNKGTGKWSSQSALELGVPQSVITESVYARYISAMKQERVE
ASKVLPKPVANVSVDKKEAIEMIRKALYFSKLMSYAQGFEQLRFASEKYDWKLQYGDLAK
IWRAGCIIRARFLQNITDAYNKKPDLQNLLRDDYFLNIAKNYQESVRDLVGVAVKAGVPV
PGLSAAISYYDSYRSAVLPANLTQAQRDYFGAHTYERTDRDGIYHYSWYTEA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggataaaccacaaattggtgttgtcggcatggcagttatgggcaagaatcttgccctg
aatattgaaagccgcggcaataccgttgctatcttcaatcgcactggcagtaaaacaaag
gcggttgttgaagagcatccggataaaaagttggtaccaagttacaaaattgaagatttt
gtcgcatcacttgagaagccacgccgaattatcatgatggttaaggctggcgctggtaca
gatgctgttattaaggaactactcccgttattggataagggcgatgtgctgattgatggc
ggtaatactttctttgaagataccatgcgccgcagtgctgagctcgacaagtcaggcatt
aactttatcggcatgggtgtttccggtggcgagttaggcgctttgcatggcccttcattg
atgccaggcggccaaaaagaagcctatgacctggtcgcaccaattctggaagccatctcc
gctaaggctgaagacggcgcaccttgtgtcacgtatatcggaccaaacggcgcaggccac
tatgtcaagatggtgcataatggcattgaatacggcgatatggaactgatcgctgaaagc
tacaacttaatgcgcaatcttcttggccttgatgtcaaagaaatggctgatattttcagt
gaatggaacaaaggcgaactggattcttacctgattgacatcactgctgacattttgact
cgcaaggatgatctcggcagtgacaaaccgattgttgacatgatccttgatcgtgccggc
aataaaggcacaggcaagtggtcctcccagtcagcacttgaattaggggtaccgcagagt
gtcattactgaatcagtctacgctcgttatatcagtgccatgaaacaagaacgggttgag
gccagcaaggtattgccgaagccggttgccaatgtttctgttgacaaaaaagaagccatt
gaaatgatccgcaaggctttgtacttcagtaagctcatgtcgtatgcccaagggttcgaa
caattgcgctttgcttcagagaagtacgattggaagctgcaatatggggacttggccaag
atctggcgcgctggctgcatcatccgcgctcgtttcttgcaaaacatcactgacgcatat
aacaagaagcccgatttgcagaacttattgcgggatgactacttcttgaatatcgccaag
aattatcaagaaagtgtccgcgacttagttggtgttgctgtcaaggctggtgtaccagtt
ccaggcctctcagccgctatcagttattacgattcctaccgttcagccgtcttgcctgct
aatctcacgcaggcacaacgtgattacttcggtgcgcacacttacgaacgaaccgatcgc
gacggcatctaccactattcatggtataccgaagcttaa

DBGET integrated database retrieval system