KEGG   Lactobacillus casei BD-II: LCBD_1982Help
Entry
LCBD_1982         CDS       T01955                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase/hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lcs  Lactobacillus casei BD-II
Pathway
lcs00900  Terpenoid backbone biosynthesis
lcs01110  Biosynthesis of secondary metabolites
lcs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lcs00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LCBD_1982
Enzymes [BR:lcs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     LCBD_1982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red Rsa3
Motif
Other DBs
NCBI-ProteinID: AEA57478
UniProt: A0A125UAN4
Position
complement(1933307..1934587)
Genome map
AA seq 426 aa AA seqDB search
MKFYELSPEKRRDQLVQEGWLTTQDAALLAGTHSLPEVTGARLIENAIGEFPLPLGVARN
LLVNGQLHQVPIADEEPSVIAAASNGARLATANGGVRTHVAAHRVVAEVVLTNLTDLVQA
RQTILAHQTDIQRVIAVAHPSMIQRGGGLDQLTVESLGAQFLKIRLTLDPQQAMGANYAN
TVAEAVAAAVTSWVDGDVLVSILTNAPTELVTAEVSLEPVSLATKAVSGDVIAKKIVQLS
DLAFVDAERAVTHNKGILNGIIGAVLATGNDTRAVAASIGAFACASGRYQPLSRWYMDQG
HLVGHLQLPLPMGAVGGAIGALPMAQVVRRLGGYQNLAIMQQVIAALGLVQNLAAMRALA
GPGIQAGHMKLQANALAIAAGATETELPMLVNALRQGSMDLKHAQQYLTTIRLNKKVGQS
KDENRD
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttacgagttgtctccggaaaagcgccgtgatcaattggttcaagaagggtgg
ttaacaacacaggatgctgcgttgttagctggtacgcatagcttgcctgaagtcacagga
gcgcgtctgatcgaaaatgccatcggcgagtttcctttacccctaggcgttgctcgcaat
ttgttggtcaatggacagctacatcaagtgcctatagcggatgaggaaccttctgtgatt
gcagctgccagtaatggggccaggcttgcgactgcaaacggcggcgttaggacccatgta
gcggcgcatcgagtggtcgctgaagtagtcctgactaacttgacggacttagtgcaagca
aggcaaacgattttggctcatcagactgatattcagagagtcattgcggttgcgcatcct
tcgatgattcaacgtggcggtggtcttgatcagttaacggtcgaatcactaggagcacag
ttcttgaaaatccgtttaacgctcgatccgcaacaggcaatgggggccaattatgcgaat
acagttgccgaagcggtcgcagcggcggtgacaagctgggtagacggtgatgtgcttgtc
agtattctaaccaacgcgccaacagaactcgtgacggctgaggtttcgcttgagccggtt
tctttagcgacgaaagctgtttctggagatgtgattgctaagaaaattgttcagcttagc
gatttagcctttgtcgatgctgagcgggcagtgacccacaacaagggcattcttaacggt
attattggtgctgtattggctactggcaatgatacccgcgctgtcgcagcaagtatcggt
gcatttgcatgtgcgtctggcaggtatcagcctttatcgcgctggtatatggatcagggc
catttagttggtcacttacagctgcccttgccgatgggggcagttggcggggcgatcggt
gctttaccaatggcgcaggttgtccgtcggctcggtgggtatcagaatttagctatcatg
cagcaagttattgccgccctcgggttggtgcaaaatcttgctgcgatgcgagcattggct
ggaccggggattcaagctggtcacatgaagttgcaagctaatgccctcgccattgctgcc
ggggcaacagaaacagaattgccgatgcttgtgaacgcacttcgtcaaggtagtatggat
ttaaaacatgcgcaacaatatttaacaaccattcgtttaaacaagaaagtaggccaatca
aaagatgaaaatcgggattga

DBGET integrated database retrieval system