KEGG   Lactobacillus casei BD-II: LCBD_1983Help
Entry
LCBD_1983         CDS       T01955                                 

Gene name
atoB2
Definition
(GenBank) Acetyl-CoA C-acetyltransferase thil
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lcs  Lactobacillus casei BD-II
Pathway
lcs00071  Fatty acid degradation
lcs00072  Synthesis and degradation of ketone bodies
lcs00280  Valine, leucine and isoleucine degradation
lcs00310  Lysine degradation
lcs00362  Benzoate degradation
lcs00380  Tryptophan metabolism
lcs00620  Pyruvate metabolism
lcs00630  Glyoxylate and dicarboxylate metabolism
lcs00640  Propanoate metabolism
lcs00650  Butanoate metabolism
lcs00900  Terpenoid backbone biosynthesis
lcs01100  Metabolic pathways
lcs01110  Biosynthesis of secondary metabolites
lcs01120  Microbial metabolism in diverse environments
lcs01130  Biosynthesis of antibiotics
lcs01200  Carbon metabolism
lcs01212  Fatty acid metabolism
lcs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LCBD_1983 (atoB2)
   00630 Glyoxylate and dicarboxylate metabolism
    LCBD_1983 (atoB2)
   00640 Propanoate metabolism
    LCBD_1983 (atoB2)
   00650 Butanoate metabolism
    LCBD_1983 (atoB2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LCBD_1983 (atoB2)
   00072 Synthesis and degradation of ketone bodies
    LCBD_1983 (atoB2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LCBD_1983 (atoB2)
   00310 Lysine degradation
    LCBD_1983 (atoB2)
   00380 Tryptophan metabolism
    LCBD_1983 (atoB2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LCBD_1983 (atoB2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LCBD_1983 (atoB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LCBD_1983 (atoB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcs04147]
    LCBD_1983 (atoB2)
Enzymes [BR:lcs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LCBD_1983 (atoB2)
Exosome [BR:lcs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LCBD_1983 (atoB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEA57479
UniProt: A0A125U9G8
Position
complement(1934599..1935780)
Genome map
AA seq 393 aa AA seqDB search
MEEVVILSAKRTPIGKLGGDLAGASAVDLGVAAAQAAIKAARIDPALLNQAIFGNVMQAG
SGQNVARQIGLKSGMATSSTAMTVNEVCGSGLKAVRLGQAAIQLGEADAVLVGGTESMSQ
VPYYAEAVRSGHKFGDTTLVDGLSRDGLNDAFSQQPMGITAENVATQFNVSRQEQDEFAL
RSHLRAAAAAAEGRFKSQIAPVTIAARHGDVIVDRDSAIRPDTSLAKLAQLPPVFEVGGT
VTAGNASGINDGAAALILMAKSKAEQLGLHYLATITGFAEVGIDPAIMGYAPKLAIDKIL
QATGGSIAAIDQIELNEAFASQSVAVARDLGLKDEQFNINGGALALGHPLGASGARILIS
LLYDLAERNQRQGIAALCVGGGIGIAMQIAMHV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagttgtgattctaagtgccaaacggacgccgattggtaagttgggtggtgat
ttggctggcgccagtgccgttgatttaggggttgcggcagcgcaggcggcaattaaggct
gcacgaattgacccagcgttactcaatcaggcgatctttggtaatgtcatgcaggctggt
tctgggcagaatgttgcccgacaaatcggattaaaaagcggtatggccactagcagcacg
gcgatgactgtcaatgaagtctgcggctcaggcctgaaggcagtgcggcttgggcaagct
gccattcaactcggcgaggctgacgcggtgcttgtgggcggtaccgaaagcatgagtcaa
gtaccttattacgccgaagcggttcgttcaggccacaaatttggcgatacaacgctggtc
gacggtttgagtcgcgatggattaaatgatgccttcagtcagcagccaatgggaatcacg
gcggaaaatgtggcgacacaatttaacgttagtcgtcaggagcaagatgagtttgctctc
cgttcgcatttacgcgccgcggccgccgcagctgagggtcggtttaagagtcagatcgcc
ccagtgacgattgctgcccgtcacggggatgtcatcgtagatcgtgattcagccattcgg
cccgatacgtcattggctaaattagcccaattaccgcctgtttttgaagtcggcggtact
gttacagcaggtaacgcaagcggcattaatgatggcgcagccgccttgatcctgatggca
aaatcgaaagccgaacaactggggctccattatttagcgacgatcactggttttgccgag
gtgggtattgatccggcaattatggggtatgcgccaaaactggcgatcgataaaatactg
caggcaaccggcggctctatcgcggcaattgatcaaattgaattgaatgaagcatttgcc
tcacaaagcgttgctgtggctcgtgaccttggtttaaaggatgaacaattcaatatcaat
ggtggcgccttagcgttgggtcatccattgggagcttcaggtgcccgaattttaatctca
ttattgtacgatctggctgaacgtaatcaacgccaaggcattgccgcattgtgcgttggc
ggtggcatcggtatcgccatgcaaatcgcgatgcatgtctga

DBGET integrated database retrieval system