KEGG   Lactobacillus casei BD-II: LCBD_2048Help
Entry
LCBD_2048         CDS       T01955                                 

Definition
(GenBank) hypothetical protein
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
lcs  Lactobacillus casei BD-II
Pathway
lcs00620  Pyruvate metabolism
lcs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LCBD_2048
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lcs02000]
    LCBD_2048
Enzymes [BR:lcs01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     LCBD_2048
Transporters [BR:lcs02000]
 Other transporters
  Primary active transporters [TC:3]
   LCBD_2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA 6PF2K AtuA
Motif
Other DBs
NCBI-ProteinID: AEA57544
UniProt: A0A125U9B4
Position
complement(2003326..2004729)
Genome map
AA seq 467 aa AA seqDB search
MPKQKVQFMETVLRDGQQSLIATRMPISDILPILDKMDAAGYASLEMWGGATFDACLRYL
NEDPWERLRKIRKAVKHTKLQMLLRGQNLLGYKNYADDVVTDFVTKSVENGIDIIRIFDA
LNDTRNLRTALEATKQAGGHAQLAICYTTSDFHTIDYFIKLAKDMADMGADSIAIKDMAG
ILTPQKAFDLVTGIKQEISVPLEVHTHATAGMAEMTYLEAVRAGADIIDTAVSPFAGGTS
QPATESMLVALQDLGYPTDVDLSTVSDIATYFAPIRDRFRESGQLNPRVKDVEPKSLIYQ
VPGGMLSNLLAQLKDQGQEALYGDVLKEVPRVRADLGYPPLVTPLSQMVGTQSLMNVMSG
ERYKLIPNEIKDYVRGLYGRPPVAIAPEMVKKIIGDAPVVTQRPADLIKPQMPEFRQAIA
QYAHDEEDVLSYALFPDQAKDFLGRREDPFYDVPEQKVSLSFEPTHD
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaacagaaagtccaattcatggaaaccgttttgcgtgacgggcaacaaagcctg
attgccacgcggatgccgatcagtgatattttgccgattctcgataagatggatgctgcc
ggctatgcatctttggaaatgtggggcggggcaacttttgatgcctgtctccgttatctg
aatgaagatccatgggaacggttgcgcaagattcgtaaggcggtcaagcacaccaaattg
caaatgctcttgcgcgggcaaaacttgttaggttacaagaactatgccgacgatgtggtc
actgactttgtcacaaagtcagttgaaaacgggattgatatcattcgtatttttgatgcg
ttgaatgatacacgcaacttgcgaacggcgcttgaagcgacgaagcaagcaggcgggcat
gcccaacttgctatttgttacacaaccagtgatttccatacgatcgactacttcatcaag
ttagccaaagacatggctgacatgggggcggattcaattgcaatcaaagacatggcaggc
attttaaccccacagaaggcgtttgatctggttaccggtattaagcaggaaatcagcgtg
ccactggaagtgcatacgcacgccaccgctggtatggctgagatgacgtatctggaagca
gttcgcgccggtgctgatatcattgataccgcggtttcgccatttgctggcggcaccagt
cagccagcaacagaatccatgctggttgcgttgcaagatcttggctatccgactgatgtt
gatttaagcacggtcagtgacatcgccacttactttgcgccgattcgcgatcgattccgc
gagtccggtcaactgaatccgcgcgtgaaagatgttgagcctaaatccttgatctatcag
gtgccaggcgggatgttgtctaacctgttggcgcaactaaaagatcaaggacaagaagcg
ctttatggcgatgttttgaaggaagtgccgcgtgtccgagctgacttaggctatccgccg
ttggttacaccgctgtcgcagatggtgggcacacaaagtttgatgaatgtcatgagcggt
gagcgttataagttgattccaaatgaaattaaggattacgtgcgcggcctttatggtcgg
ccgccagtggcaattgcacccgaaatggtgaaaaagatcattggtgatgcaccggttgtc
acacaacgtcccgcggatttaatcaagccgcaaatgcctgagttccgtcaagcgattgcg
caatatgcgcacgacgaagaggatgtcttaagctatgctttgttcccagatcaagctaaa
gattttcttggccgacgcgaagatccgttttatgatgtgccggagcagaaggtgtcgcta
agttttgagccgacgcatgattga

DBGET integrated database retrieval system