KEGG   Lactobacillus casei BD-II: LCBD_2339Help
Entry
LCBD_2339         CDS       T01955                                 

Gene name
ackA1
Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
lcs  Lactobacillus casei BD-II
Pathway
lcs00430  Taurine and hypotaurine metabolism
lcs00620  Pyruvate metabolism
lcs00640  Propanoate metabolism
lcs00680  Methane metabolism
lcs01100  Metabolic pathways
lcs01120  Microbial metabolism in diverse environments
lcs01200  Carbon metabolism
Module
lcs_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:lcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LCBD_2339 (ackA1)
   00640 Propanoate metabolism
    LCBD_2339 (ackA1)
  09102 Energy metabolism
   00680 Methane metabolism
    LCBD_2339 (ackA1)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    LCBD_2339 (ackA1)
Enzymes [BR:lcs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     LCBD_2339 (ackA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AEA57834
UniProt: A0A454XTZ4
Position
2289956..2291161
Genome map
AA seq 401 aa AA seqDB search
MAKVLSINAGSSSLKWKLFEMPSERQLAEGATDILKQSTVKIKYGTDQAYESATPICNYR
DAVANLLSNLQTLGLVQNLDEITGIGHRVVAGGELFSAPIVIDDRVLAQIRALRDYAPLH
NPVEADCIAIFRKMMPWALEVAVFDTAFHQTMKPVNYLYSIPYEYYQKYGVRKYGAHGTS
VRYVSAHAAKMLRKPLAQMRMIVMHLGAGSSITAIQNGQSVDTSMGFTPLSGVTMGTRSG
DVDVSLIGYLMKKLAITDVDQMIDILNTESGLRGISGISHDVRDLEAAAPTNPRAKLALD
IFVNRIVKYVGAYAALMDGVDVLVFTAGIGEHSSDIRARVMQSLDYLGARIDASLNTQIH
DNAGDITAADSKVKTLVIPTNEELMIVRDVMSLSQAVAQAE
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagttctctccatcaacgctggcagctcctcactcaaatggaagctgttcgag
atgccaagtgagcgtcagcttgcagaaggcgcgactgacatcctgaaacaatcaaccgtc
aagatcaagtatggtactgatcaagcttacgaaagcgctaccccaatttgcaattatcgt
gacgctgttgccaacctgctctctaacctgcaaacactcggactcgttcaaaatttggat
gaaattaccggcattggccatcgcgtggtagctggcggggaattattttccgccccaatt
gtcattgatgatcgtgttctggcgcagattcgtgctctgcgtgattatgctccgctccac
aatccggttgaagccgactgtatcgccatctttcgcaaaatgatgccttgggcacttgaa
gtcgcagtatttgataccgcatttcatcaaaccatgaaaccagtcaattatctttacagt
attccgtatgagtattatcaaaagtatggtgtccgtaaatacggtgcgcatggaaccagc
gttcgctatgtgagtgctcacgctgccaaaatgcttcgcaaaccattggcacaaatgcga
atgattgtgatgcatcttggggcgggttcaagcatcacggccatccaaaacgggcaatcg
gttgacacatcaatgggctttacccctttgtccggtgtcacgatgggcacgcgttcaggc
gatgttgatgtgtcactcatcggctatctgatgaagaaacttgccatcaccgatgtcgat
caaatgattgatatcttaaacacagagtcaggcttacgcgggatctccggcattagtcat
gatgttcgcgaccttgaagccgctgcgccgactaacccgcgggccaaactggcgcttgat
atctttgtgaaccgcattgttaaatatgtcggtgcttatgccgccttgatggacggtgtc
gatgtcctagtcttcacagccggcatcggcgaacacagcagtgacattcgggcacgcgtc
atgcaatctttagattatctcggcgcgcggattgatgcgagcttaaacactcaaatccac
gataacgcaggtgacattactgcagctgattcaaaggtcaaaacactggtcatccccaca
aatgaagaattgatgatcgtccgcgacgtcatgtccttaagccaagcagtggcgcaagcg
gaatag

DBGET integrated database retrieval system