KEGG   Lactobacillus casei BD-II: LCBD_2608Help
Entry
LCBD_2608         CDS       T01955                                 

Gene name
gabD-2
Definition
(GenBank) Succinate-semialdehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
lcs  Lactobacillus casei BD-II
Pathway
lcs00620  Pyruvate metabolism
lcs00630  Glyoxylate and dicarboxylate metabolism
lcs01100  Metabolic pathways
lcs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lcs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LCBD_2608 (gabD-2)
   00630 Glyoxylate and dicarboxylate metabolism
    LCBD_2608 (gabD-2)
Enzymes [BR:lcs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     LCBD_2608 (gabD-2)
    1.2.1.22  lactaldehyde dehydrogenase
     LCBD_2608 (gabD-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487
Motif
Other DBs
NCBI-ProteinID: AEA58103
UniProt: A0A125UCW1
Position
complement(2544034..2545500)
Genome map
AA seq 488 aa AA seqDB search
MAELQSTHYQMYINGKFMDSASGDVETVIDPSTGKKLWTAPAATIEEARAAVDAAWAAKN
AWRRVPAPTRGAYLRKLATLVREHEDELVKILMLEQGKIHALAKTEIEFSADYFDYMANA
ARVYSGDVMQSDNENENIIIARQPIGVAVGIIAWNFPFFLIARKMGPALVTGNTIVIKPS
SDTPGLALAFAKLVDEVGLPAGVANFVSGRGSIIGDDLAKNPKVGIISLTGSTASGKKVM
AAAANHVAKMSLELGGKAPAIVAKDADIDLAVQAIFDSRIDNNGQICNNAERIYVQEDVA
DEFIKKMTAKMAAVKVGNPNTDPDAEMGPLINQGALDKVDGLVQRAVEAGGQIQTGGHPA
DIDGGFFYEPTVITNVAQDSEIVQNEIFGPVLPILTFKTIPEAIEMANDTVYGLTSSVYT
RDLETASYVANEIEFGETYINRFNFEGIQGFHAGWKQSGVGGADGIHGVEEFTNTHVIYL
QRHPENLK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattgcagtcaacgcactatcagatgtatatcaatggcaagttcatggattcg
gcatcaggcgatgttgaaaccgtgatcgatccttccacaggcaagaaattgtggacggca
ccggcagcgacaattgaggaagcccgcgcagccgtggatgctgcttgggcggctaagaat
gcttggcggcgcgtgcctgctccaacgcgtggtgcgtacttgcgcaagcttgctacttta
gtgcgtgagcatgaagatgaactggtgaagattttgatgttggagcaagggaaaattcat
gccttagcgaaaaccgaaattgagttttcggcggattattttgactatatggccaacgcc
gcacgcgtttattccggcgatgtgatgcaatctgacaatgaaaacgaaaatattatcatt
gcccgtcagccaatcggtgttgcggttggtattattgcttggaacttcccgttcttcctg
attgctcggaaaatggggccagctttggtaaccggcaataccatcgtgatcaaaccaagt
tcggacaccccaggactggcgttggcatttgcaaaactggttgatgaagtcggtttgccg
gcaggggtagccaactttgtgagtggtcgcgggtccatcattggggatgatttggcgaag
aaccccaaagtcggcattatcagcctgactgggtccaccgcgtccggtaagaaggtcatg
gcagctgcggcgaatcatgtggcaaagatgtcattggaacttggtgggaaggcaccggca
attgttgctaaggatgctgatatcgatttagctgtgcaggccatttttgactcgcgaatt
gataacaatgggcaaatttgtaacaacgctgaacggatttatgtgcaagaagatgttgcg
gatgagtttattaagaaaatgacggcaaagatggcggcggtgaaagtcggtaatccgaac
actgatccagatgccgaaatgggtccgttgatcaatcaaggcgcccttgataaagtggac
ggtttggttcagcgggcggttgaagcaggcggccagattcaaacaggtggtcacccagct
gacattgacggtggtttcttctacgaaccaactgtgattaccaatgtcgcgcaggattca
gagattgtgcaaaatgagatcttcggaccggtgttgccgattttgacattcaagaccatt
ccagaagcaatcgaaatggcgaatgacacggtatatggcctgaccagctccgtttatacg
cgtgatctggaaaccgcttcgtatgttgctaacgagattgagtttggcgagacctacatt
aaccgattcaactttgaaggcatccaaggcttccatgctggttggaaacaatctggtgtc
ggaggcgccgatggtattcacggtgttgaagaatttaccaacacacatgtcatttattta
cagcgtcacccagaaaacttaaaataa

DBGET integrated database retrieval system