KEGG   Lactobacillus crustorum: BI355_1683Help
Entry
BI355_1683        CDS       T04712                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lct  Lactobacillus crustorum
Pathway
lct00071  Fatty acid degradation
lct00072  Synthesis and degradation of ketone bodies
lct00280  Valine, leucine and isoleucine degradation
lct00310  Lysine degradation
lct00362  Benzoate degradation
lct00380  Tryptophan metabolism
lct00620  Pyruvate metabolism
lct00630  Glyoxylate and dicarboxylate metabolism
lct00640  Propanoate metabolism
lct00650  Butanoate metabolism
lct00900  Terpenoid backbone biosynthesis
lct01100  Metabolic pathways
lct01110  Biosynthesis of secondary metabolites
lct01120  Microbial metabolism in diverse environments
lct01130  Biosynthesis of antibiotics
lct01200  Carbon metabolism
lct01212  Fatty acid metabolism
lct02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BI355_1683
   00630 Glyoxylate and dicarboxylate metabolism
    BI355_1683
   00640 Propanoate metabolism
    BI355_1683
   00650 Butanoate metabolism
    BI355_1683
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BI355_1683
   00072 Synthesis and degradation of ketone bodies
    BI355_1683
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BI355_1683
   00310 Lysine degradation
    BI355_1683
   00380 Tryptophan metabolism
    BI355_1683
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BI355_1683
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BI355_1683
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BI355_1683
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lct04147]
    BI355_1683
Enzymes [BR:lct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BI355_1683
Exosome [BR:lct04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BI355_1683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APU71988
UniProt: A0A1L7IEI6
Position
complement(1702876..1704030)
Genome map
AA seq 384 aa AA seqDB search
MDPIVIIDAKRTAIGKFRGQFADLTAVQLGTQLVSKLLKNNQVDPKIVDQFIFGNVYQTG
MGQNTARQIELDVGGRVDATAMTINQVCGSGMKAIYEGISAITMGNAEIVVAGGVESMSN
APFYAPRTGKMEVSPKLSDSLFNDGLNDAFNHLPMGITAENIAKKYHVTRQQQDEFAYSS
HQKAHQAHDKLAKEILAIDVDGNQVDTDQSIRPTTTLEQMGQLRTVFDKKGTVTAGNSSP
INDGAAALILMRASRAKELGLNYVAEVTGYTEIGIDPNYMGYAPYYAIKKYFDRYKTSAA
DYDLYEVNEAFASQAVAVSRDLKLPEDSLNIYGGAIALGHPLGATGARIIATLINSLQQE
QKATGLASLCIGGGMGMAMGVKLV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggatccaattgtaattatagatgcaaagagaactgcgattggcaaattcagagggcaa
tttgctgatttgacggcagttcaattaggaacgcaattagtttcaaaactattaaaaaat
aatcaggttgaccctaaaattgtggatcaatttatttttggaaatgtttatcaaactggt
atggggcaaaatactgctcgacagattgaactggatgttggtggacgcgtcgatgctact
gccatgacaattaatcaggtttgtggctcagggatgaaggctatctatgagggaatttcc
gctattacgatgggaaatgctgaaatcgttgttgccggtggagttgaaagcatgtcgaat
gctccattttatgcacctagaactggcaaaatggaagttagtcctaaattgtctgactca
ctctttaatgatggcctaaatgatgccttcaatcatttaccaatgggtatcactgctgaa
aacattgctaaaaaatatcatgtaactcggcaacagcaagatgagtttgcatatagttct
catcaaaaagctcatcaggcccatgataagctagctaaggaaattttggcaattgatgtt
gatggcaatcaagttgatactgaccaatcaattcgtcctactacaactttggaacaaatg
ggacaactaagaactgtctttgacaaaaaaggtacagttactgccggtaattcatcacca
attaatgatggtgctgctgctctaattttaatgagagccagtcgagctaaggaattagga
cttaattacgtagcagaggttacaggttatactgagattggaatcgaccctaattatatg
ggctatgcaccatattatgctattaagaagtattttgatcgttacaagactagtgcagct
gattatgacttatatgaagttaatgaagcttttgcttctcaagctgtggccgttagtcga
gatttgaaattgcctgaagacagtttaaatatttatggcggcgcaattgccttaggacat
cctttaggagccacaggagcaagaataattgctactttgatcaattctttgcagcaagaa
caaaaggctactggcttagcctcattatgtattggtggtggcatgggtatggctatgggt
gtgaaacttgtatga

DBGET integrated database retrieval system