KEGG   Lactobacillus crustorum: BI355_1813Help
Entry
BI355_1813        CDS       T04712                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lct  Lactobacillus crustorum
Pathway
lct00480  Glutathione metabolism
lct00590  Arachidonic acid metabolism
lct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lct00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BI355_1813
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BI355_1813
Enzymes [BR:lct01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BI355_1813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: APU72112
UniProt: A0A1L7IG61
Position
complement(1840280..1840750)
Genome map
AA seq 156 aa AA seqDB search
MSKIYEFSETEMNGFTIDFKDYQGEVLLIVNTASKCGLAPQFEGLEALYQKYHDQGLEVL
GLPSNQFHQELADDKETSDYCQMHYGVTFPMTKRIEVNGNQEDPLFTYLKDAAGHGKIKW
NFTKFLVSRDGETIERFAPVTKPEKIEPKILEALKR
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaatttatgaattttcagagacagagatgaatggttttacaattgatttcaaa
gattatcaaggagaagtattattgattgtaaatactgccagcaagtgcggcttagctccc
caatttgagggactagaggctctatatcaaaagtatcatgatcaaggcctagaagtatta
ggattaccttcaaatcaatttcatcaggaattagctgatgataaagaaactagtgattat
tgtcagatgcactatggcgttacatttccaatgactaaacgaattgaggtcaatgggaat
caagaagatccattatttacatatttgaaagatgcagctggtcatggcaaaataaaatgg
aattttaccaaatttttagttagtcgtgatggtgaaacaattgaacgttttgcaccagtt
actaaacctgaaaagattgaacctaaaattttggaagcattaaaaagataa

DBGET integrated database retrieval system