KEGG   Lactobacillus crustorum: BI355_2044Help
Entry
BI355_2044        CDS       T04712                                 

Definition
(GenBank) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
lct  Lactobacillus crustorum
Pathway
lct00220  Arginine biosynthesis
lct00330  Arginine and proline metabolism
lct01100  Metabolic pathways
lct01110  Biosynthesis of secondary metabolites
lct01130  Biosynthesis of antibiotics
lct01230  Biosynthesis of amino acids
Module
lct_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:lct00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BI355_2044
   00330 Arginine and proline metabolism
    BI355_2044
Enzymes [BR:lct01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BI355_2044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: APU72338
UniProt: A0A1L7IFI4
Position
2083590..2084450
Genome map
AA seq 286 aa AA seqDB search
MSKTIRLSIPDWQAGNNFVYYFGAQLLNWLAPKNQNQKTIQIPIVAPTKDNSKLLPENGV
TAQSIVKRNVEMATKIINKENPDKIITLGGNCLVSQAPFNYLHEKYGDKLGIIWIDAHPD
ISTPEIFPNEHAMVLGNLLGKGDPQLAKLVKHPLAPESILYVGLQELTPDEKDIMPSLGI
NYQIEKNDQVDVDKIEKWIEKNGFEKIAIHFDLDVLDPNLFFDQFFNKPGVSDYGVSNGD
LNPDKAISLLSTLENDTEVVGLTIAEYLPWSALKLRELMEKSQIFN
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacaatcagactatctatccccgactggcaagccgggaacaatttcgtttat
tattttggagcacagctacttaactggttagctcccaaaaatcagaatcaaaagactatt
caaataccaatagttgcaccgacaaaagacaattctaaattattacctgaaaatggagta
accgcccaatcaattgtaaaaagaaatgttgagatggctacaaaaataatcaacaaagaa
aatcccgataaaattatcacactaggtggtaattgcttagtctctcaggcaccatttaat
tacttacatgaaaaatatggagataaattaggtattatttggatcgacgcccatcctgat
atctcaaccccagaaatttttccaaatgaacacgccatggttttaggaaacttgcttggt
aagggtgatccacaattagcaaagctagttaaacatccccttgcaccagaatctatactt
tacgttggtctccaagaattaactcctgatgaaaaagatataatgcctagtctaggaatc
aattatcaaatcgaaaaaaacgatcaagttgatgtcgacaaaatcgaaaagtggatcgag
aaaaatggttttgaaaaaattgctatccattttgatttagatgtcctcgatcctaattta
ttctttgatcaattcttcaacaagcctggtgttagtgattatggagtttctaatggcgac
ttgaatcctgataaagccatcagtttattaagcaccctagagaatgatacggaggttgtt
ggtttaacaattgctgaatatttaccttggagtgctttaaaacttcgagaattaatggaa
aagtctcaaatttttaactaa

DBGET integrated database retrieval system