KEGG   Lactobacillus crustorum: BI355_2271Help
Entry
BI355_2271        CDS       T04712                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lct  Lactobacillus crustorum
Pathway
lct00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BI355_2271
Enzymes [BR:lct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BI355_2271
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BI355_2271
    1.1.1.-  
     BI355_2271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: APU72562
UniProt: A0A1L7IHE1
Position
unnamed1:complement(41768..42850)
Genome map
AA seq 360 aa AA seqDB search
MTMVKAAVIYGPKDIRFEKRDIPDPEPDEVQIEVAFNGICGSDIHEYLEGMDLATTPHPL
THMQAPLIPGHEFSGTIFKIGKQVSKLKIGDKVAVEPMIACGKCPECLAGHYNWCEHAIG
SDQSAGFLGFSANGGLAEKCNVKSTFAHLLPDNFPLDLGALVEPVAVAAQAVIVSRVSPG
DDVLVQGAGPIGLFTALIAQISGAHRVIINDMSEERLNLAKELGIQYPIRTESQKSLAHA
ISTITENQGVDIAFDCAGVQPTLTGAVQALKNGGKVTVIALFQHPPVVDVRALLKKGGSL
LTSYGYANIFDRVIKIIDTHRSLFEHVITKKIELNELVSEGIESLERDKKQAKILVRLHS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgactatggtaaaggcagctgttatctacggtcctaaggatatccgctttgaaaaaaga
gatatccctgaccccgaaccagatgaagttcaaattgaggttgcatttaatggtatttgc
ggtagtgatattcatgaatatttagagggtatggatttggcaacaacgcctcatccgcta
acccatatgcaagctccgctaattcctggacatgaattctcgggaacaattttcaaaatt
ggaaaacaagtctctaaattaaaaattggggataaggttgcagtcgagccaatgattgct
tgcggaaaatgtccagaatgtcttgctggtcattataattggtgtgaacatgctataggt
agtgatcaatcagcaggattcttaggattttcagctaacggtggtttagctgaaaagtgc
aatgtcaaaagtacctttgcacatctcttgccagataattttccgcttgatttaggagcc
ttagttgaaccagttgcggttgctgcacaagcagttatagtaagtcgagtgtctcctgga
gacgatgtcttagttcaaggtgctggcccaattggtttgttcacagctttaatcgcacaa
atttctggtgcacatcgtgtgataataaacgacatgtcagaggaacgtttgaatttagca
aaggaattaggcattcaatacccaatacgcactgagagtcaaaagtcattagctcacgct
atcagcactatcactgaaaatcagggagtagatattgcatttgattgtgctggtgtacaa
cccacacttactggtgccgttcaggctcttaaaaacggtggtaaggttaccgtgattgca
ttatttcaacatccaccagttgtagatgttagagctctgcttaaaaagggaggcagttta
ttaacatcttatggatatgccaatatctttgatcgagtaattaagattatcgacacccat
cgatcactattcgaacatgtcattacaaaaaagattgaattaaacgaattagtctcagaa
ggaattgagtccttagaaagagataaaaaacaagcaaagattttagttcgcttacattct
tag

DBGET integrated database retrieval system