KEGG   Lactobacillus curieae: PL11_002265Help
Entry
PL11_002265       CDS       T04707                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
lcu  Lactobacillus curieae
Pathway
lcu00230  Purine metabolism
lcu00250  Alanine, aspartate and glutamate metabolism
lcu01100  Metabolic pathways
Module
lcu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:lcu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PL11_002265
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PL11_002265
Enzymes [BR:lcu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     PL11_002265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AQW20821
UniProt: A0A1S6QGU6
Position
441537..442820
Genome map
AA seq 427 aa AA seqDB search
MSSIVIVGSQWGDEGKGKITDFFSQNANITARYQGGDNAGHTIVFNDEKFHLQLIPSGIF
DKDKTSIIGNGVVVNPKSLITEMDYLIDHGVSVDNLLISNRAHVIMPYHTLLDELQEQHR
GNKIGTTKKGIGPAYMDKYERIGIRIADLIDKDEFYKRLKATLEIKNELLTKLYGVEPLS
FEAIYKEYNEYADRIREHVVDSSYLINKALDDKQNVLFEGAQGSMLDIDEGTYPFVTSSN
ASAAGVAAGAGIGPSRVDHVIGVCKAYTSRVGEGPFPTELHDEIGNHIREVGHEYGVVTH
RPRRIGWFDSVVLRHAARVSGFTHLALNSLDLLTGIETLKICTAYKLNGETIEHYPASLS
ELDKCEPVYEELPGWEEDITSCKTIDELPKNAQNYLNRVSELVNVPFATFSVGPDRNQTN
IVSNVWD
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctattgtgatcgttggaagtcagtggggagacgaaggaaaaggtaagattacc
gatttcttcagccaaaacgcaaatatcaccgcccgttatcaaggcggagacaacgctggc
cacaccattgtctttaacgacgaaaagttccatcttcaactcattccttcaggaatcttt
gataaggacaaaacttccattatcggtaacggggtcgtagttaatcctaagtccctcatc
accgagatggattacctcattgatcacggtgtatcagttgacaatctactgatttcaaat
cgtgctcatgtcattatgccataccacactttacttgatgaacttcaagaacaacatcgt
ggaaataagattgggactaccaaaaaaggtatcggcccagcttacatggataaatacgaa
cgaattggaatcagaattgccgacttgatcgacaaagatgaattttacaaacgcttaaaa
gcaactctagaaatcaaaaatgaactattaactaagctttacggggttgaaccacttagc
ttcgaagctatctataaagaatataacgaatacgctgaccgcattagagaacacgttgtc
gactcatcatacctgatcaataaggctctcgacgacaaacaaaacgttctgttcgaaggt
gctcaaggttcaatgctagacattgatgaaggaacgtatccattcgttacctcatcaaac
gctagtgccgctggtgttgccgctggtgccggaattggccctagccgagtagaccacgta
attggtgtttgcaaggcttacacatctcgagttggtgaaggtccattcccaactgaattg
catgacgaaatcggtaatcacatccgtgaagtcggtcatgagtacggagttgttacccac
cgtccaagaagaattggttggtttgacagcgttgttctacgccacgcagcccgtgtaagt
ggctttactcacctcgccttaaactcgcttgatttacttactggaatcgaaactctaaag
atttgtaccgcctacaagttaaatggtgaaacaatcgaacattatccagcaagtttgagt
gaattagacaagtgcgaaccagtatacgaagagttacctggctgggaagaagacatcacc
agctgcaagacaattgatgaattaccaaagaatgcccaaaattatttaaaccgcgtatct
gaattggttaacgttccgttcgccactttctcagttggcccagatcgtaaccagacaaac
atcgtaagcaacgtttgggattaa

DBGET integrated database retrieval system