KEGG   Lactobacillus curieae: PL11_004625Help
Entry
PL11_004625       CDS       T04707                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lcu  Lactobacillus curieae
Pathway
lcu00071  Fatty acid degradation
lcu00072  Synthesis and degradation of ketone bodies
lcu00280  Valine, leucine and isoleucine degradation
lcu00310  Lysine degradation
lcu00362  Benzoate degradation
lcu00380  Tryptophan metabolism
lcu00620  Pyruvate metabolism
lcu00630  Glyoxylate and dicarboxylate metabolism
lcu00640  Propanoate metabolism
lcu00650  Butanoate metabolism
lcu00900  Terpenoid backbone biosynthesis
lcu01100  Metabolic pathways
lcu01110  Biosynthesis of secondary metabolites
lcu01120  Microbial metabolism in diverse environments
lcu01130  Biosynthesis of antibiotics
lcu01200  Carbon metabolism
lcu01212  Fatty acid metabolism
lcu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PL11_004625
   00630 Glyoxylate and dicarboxylate metabolism
    PL11_004625
   00640 Propanoate metabolism
    PL11_004625
   00650 Butanoate metabolism
    PL11_004625
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PL11_004625
   00072 Synthesis and degradation of ketone bodies
    PL11_004625
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PL11_004625
   00310 Lysine degradation
    PL11_004625
   00380 Tryptophan metabolism
    PL11_004625
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PL11_004625
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PL11_004625
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PL11_004625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcu04147]
    PL11_004625
Enzymes [BR:lcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PL11_004625
Exosome [BR:lcu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PL11_004625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AQW21261
UniProt: A0A1S6QI30
Position
complement(962643..963809)
Genome map
AA seq 388 aa AA seqDB search
MTKTYITQAKRTPIGKLGGHLSSYSAEQLGTISTKTVINAANISTDQIDQVIFGNAIQAG
NGQNVARQIEINSGIPNTKTAFTVNQVCGSGLKAIHQAYSAIQLNEANNIIAGGTESMTN
VPFYNKHVRSGNKFGSIVLEDGLNRDGLNDSFSGLPMGMTAENIAERFQVSREEQDEFAL
NSHLKAQQAVNNHYFNREIIPIGPKDKPITQDQGIRFDTSLEKLSSLNPVFKENGTVTAG
NAAALNDGASALLISSEQSVAENRLTPLAEIIDYTEVGIDPQIMGYAPYHAISTLMDKLH
MNVSDIDLFEINEAFASQAYAVSRDLHIPDIKLNISGGALALGHPLGDSGARIVTTLINN
LIRTEKTYGIASLCMGGGMGAAIAIKIV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaaacgtacatcacacaagcaaaacgaacccccataggaaaacttggtggtcat
ttatcatcatatagtgctgaacaacttggaacaatttccactaaaacagtcatcaatgct
gccaatatttcaacagatcaaatagatcaagttatctttggaaacgcaattcaggctggt
aacggccaaaatgttgccagacaaatagaaattaacagcggcatccccaacactaagacc
gcattcacagtcaatcaagtttgtgggtctggcttaaaggcaattcaccaagcatactca
gcaattcaattaaatgaagcaaacaatatcattgctggtggaacggagagcatgactaac
gttccgttttataataaacacgttaggtctggtaacaagttcggttccatcgtcttagaa
gatgggcttaaccgagatggcctaaacgattctttttctggcctcccaatgggaatgaca
gctgaaaacatcgcggaacgttttcaagtaagccgtgaggagcaagatgaattcgcacta
aactcacatttaaaagcccaacaggcagtcaacaaccattacttcaatcgggaaatcatt
cctatcggtccaaaagacaagcccattactcaagaccagggaatccgatttgacaccagt
ttagaaaagttgagtagcctcaaccctgtatttaaagaaaatgggactgtaactgctgga
aatgcagctgcacttaacgatggtgcaagcgcactgctcatatcatccgaacaatccgtc
gcagaaaaccggcttacacccttagcagagattatcgattacactgaagtgggaatcgat
ccccagataatgggatacgccccatatcatgcaatttcaaccctaatggataagctacac
atgaatgtgtcagatattgatttgtttgaaatcaatgaggcgtttgcctcacaagcttat
gcagttagccgagacctgcacatccctgatatcaaactaaacatttcagggggcgcttta
gcattaggacacccacttggtgattcaggggccagaatcgtaaccaccctcatcaataac
ctaattcgtacagaaaaaacgtacggaatcgcatcactatgtatgggcggtggcatggga
gcagccattgcaatcaaaatagtttaa

DBGET integrated database retrieval system