KEGG   Lactobacillus curieae: PL11_004670Help
Entry
PL11_004670       CDS       T04707                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
lcu  Lactobacillus curieae
Pathway
lcu00030  Pentose phosphate pathway
lcu00480  Glutathione metabolism
lcu01100  Metabolic pathways
lcu01110  Biosynthesis of secondary metabolites
lcu01120  Microbial metabolism in diverse environments
lcu01130  Biosynthesis of antibiotics
lcu01200  Carbon metabolism
Module
lcu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PL11_004670
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PL11_004670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcu04147]
    PL11_004670
Enzymes [BR:lcu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     PL11_004670
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     PL11_004670
Exosome [BR:lcu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PL11_004670
  Exosomal proteins of colorectal cancer cells
   PL11_004670
  Exosomal proteins of bladder cancer cells
   PL11_004670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AQW21266
UniProt: A0A1S6QI35
Position
complement(975261..976745)
Genome map
AA seq 494 aa AA seqDB search
MPTERRSLIMLFGATGDLATRKLYPAIFNLYKKGNLKEHFAVIGTSRYKFDDEKFRETVS
KSVSEKGVDKKLVESFIKHFFFVTHDVTDLDHYSVLKEKAEELDKKFKLEGNRVFYISMA
PNFFGTVAKNLKNQGLLTEGKGFNRLVIEKPFGRDFESAKELNDALSESFEENQIYRIDH
YLGKEMIQNIEAVRFGNTIFEALWNNRYIDNIQVTLAENLGVEERAGYYDNSGALRDMVQ
NHIMQIVSLLAMEQPVAFKDTDIRSEKVKALRSLRVYNVAEASTNFVRGQYSASGDGETK
EYREEDGVPADSNTETFVAGKLLFDNYRWSGVPFYIRTGKKLADKFTRVDVVFKKPLVDI
FSFPQDGNTLLSPNVLTIHIEPEQGFSLVVNAKNGEQGFHTEPVNLDFYENSQRTKATPQ
PYERLIHDVLKGDGTNFSSWPEVASAWKFVDQIRRVWDIQQPMFPNYIPGSMGPVAADEL
LARDHREWIYKLNQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttgccaactgaaagacgttcgttgattatgcttttcggtgcaaccggagatttagcaact
agaaagttgtacccagcaatctttaacctttataaaaaaggtaacttaaaggaacatttt
gccgttattggtacttctcgttacaagtttgatgatgaaaaatttagagaaacagtttca
aaatctgtatctgaaaagggtgttgacaagaagcttgttgaatcattcatcaagcatttc
ttctttgttacccatgacgttaccgacctagatcattactcagtcttgaaagaaaaggct
gaagaacttgataagaagttcaagctagaaggtaaccgagtattctacatctcaatggca
ccaaacttctttggtactgttgctaaaaaccttaaaaatcaaggacttcttacagaaggc
aaaggcttcaaccgtcttgtaattgaaaaaccattcggtcgtgatttcgaatctgctaag
gaattgaatgatgcacttagcgaatcatttgaagaaaaccaaatctaccgtatcgaccac
tatcttggtaaagaaatgatccaaaacatcgaagctgttcgttttggaaacacaatcttc
gaagccctttggaacaaccgttacatcgacaacatccaagttacattagctgaaaatctt
ggtgttgaagaacgtgccggttattacgataactcaggtgcccttcgtgacatggttcaa
aaccacatcatgcaaatcgttagtttgcttgctatggaacaacctgttgccttcaaggat
actgatattcgttctgaaaaagttaaggctttgcgtagtcttcgtgtctacaacgttgcc
gaagcttcaaccaactttgttcgcggccaatacagtgcatctggtgatggtgagaccaaa
gaataccgtgaagaagatggtgttccagcagattcaaacactgaaacattcgttgcaggt
aagctattatttgataactaccgttggtcaggagttcctttctacattagaactggtaaa
aaacttgctgacaagttcaccagagttgacgttgtctttaagaagcctttagtggacatt
ttctcattcccacaagatggcaacacattgcttagccctaacgtattgacaatccacatc
gaaccagaacaaggattctcacttgtcgttaacgctaagaatggtgaacaaggattccat
actgaaccagttaacttggacttctacgaaaactcacaacgtactaaagcaactccacaa
ccatacgaacgtttgattcatgacgtacttaagggtgacggtactaacttctcaagttgg
ccagaagttgccagtgcatggaagtttgttgaccaaattcgtcgcgtttgggacattcaa
caaccaatgttccctaactacatccctggatcaatgggaccagttgctgctgatgaatta
ttagcacgtgaccaccgtgaatggatttacaaattaaatcaataa

DBGET integrated database retrieval system