KEGG   Lactobacillus curieae: PL11_007105Help
Entry
PL11_007105       CDS       T04707                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lcu  Lactobacillus curieae
Pathway
lcu00450  Selenocompound metabolism
lcu00970  Aminoacyl-tRNA biosynthesis
lcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PL11_007105
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PL11_007105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lcu01007]
    PL11_007105
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lcu03016]
    PL11_007105
Enzymes [BR:lcu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PL11_007105
Amino acid related enzymes [BR:lcu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PL11_007105
Transfer RNA biogenesis [BR:lcu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PL11_007105
 Prokaryotic type
   Other AARSs
    PL11_007105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AQW21701
UniProt: A0A1S6QJB6
Position
1483501..1485528
Genome map
AA seq 675 aa AA seqDB search
MAESKPTYYITTPIYYPSGRLHIGNSYTTIACDAEARFKRSMGFDVFFLTGTDEHGLKIE
QKAEALNTTPQAYVDDMAATIKKLWKTLEISNDKFIRTTDEYHEKAVAEIFDKLLQQGDI
YLGEYEGWYSVSDEEYFTESQLAEVYKDDDGKVIGGKAPSGHEVQLVKEQSYFFKMSKYA
DWLLQYYKDNPTFIQPEARMNEMIKNFIEPGLEDLAVSRTTFNWGVPVKSDPKHVVYVWI
DALSNYITALGYGSNDQSEFNKYWPADVHMVGKEIVRFHTIYWPIILHALGLPLPKQVFG
HGWLLMKDGKMSKSKGNVIYPETLVDRYGLDAVRYYLLRAMPYGNDGIFTPEDFIDRVNY
DLANDLGNLLNRTVSMVNKYDGGVVPDLQSGITEFDKGLEDTSAEVVANFKKLMNKLHFA
DALSEVWKLVSASNKYIDQTEPWVLAKDDAKKEQLDSVMAHLVAALRVIAELVSPVMTHA
PKEIFAQLGISDEIDLTTLSFADLKGGVKVAEKGQPIFPRLDSEVEVNFIKEQMTKSDKA
KGRAAMKEAAENTFDPESTELKSDKKEVRFEAFEKIELKVAQIKSVNKVEGADKLLQFRL
DAGDDGDRQILSGIAQWYPDYEKLVGKKVIIVGNLKPRKMKGEVSQGMLLSVEHDNGDVE
LVTIPDNLPNGSTLE
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaagtaagccaacatattacattacaacgccaatttactatccttctggtaga
ttgcatattggaaattcatacacaactattgcttgtgacgcagaagcaagatttaagcgc
tcaatgggctttgacgttttcttcttaactggaactgacgaacacggtttgaagatcgaa
caaaaagctgaggccttgaataccaccccacaagcttacgttgatgatatggcagcaacc
atcaaaaagttatggaaaacgcttgaaatttctaacgataagtttattcggacaactgat
gagtaccacgaaaaagcagttgctgaaatttttgacaagttactgcaacagggcgatatt
taccttggtgaatacgaaggttggtattctgtttctgatgaagaatacttcactgaaagc
caattagccgaagtttataaggatgatgatggcaaggtcattggtggaaaagctccgtca
ggccacgaagtccaactggttaaggaacagtcatacttctttaaaatgagtaagtatgct
gactggttgcttcaatattacaaagataatccaactttcattcaaccagaagcaagaatg
aacgaaatgattaaaaactttattgaaccaggtttggaagatctggctgtaagtagaaca
acatttaactggggagtcccagtaaagtctgatcctaagcacgttgtttacgtttggatc
gatgcactctcaaactatataactgcgctaggatatggttcaaacgaccagtctgaattt
aacaagtattggcctgctgatgttcatatggttggtaaggaaattgttcgtttccacact
atttactggccaattatccttcacgcactaggattaccattgccaaaacaagtatttggt
catggttggttactgatgaaggacggtaagatgtctaagtctaagggaaacgtaatttat
ccagaaactttggtagaccgttacggactagatgctgttcgttattacttgcttagagca
atgccttacgggaacgacggaatctttaccccagaagactttattgatcgggtcaactac
gaccttgctaatgaccttggaaacctattgaacagaactgtctcaatggttaacaagtat
gatggcggagttgttcctgaccttcaaagtggaattaccgagtttgataagggactagaa
gatactagtgctgaagttgtcgctaactttaaaaagttaatgaataagcttcactttgct
gatgcattgagtgaagtttggaagttagtttcagcttctaacaagtacattgaccaaaca
gaaccttgggttttggctaaagacgatgctaaaaaagaacagttggattcagtgatggct
cacttagttgctgcattgagagtgattgcggaattagtaagcccagttatgacccacgca
cctaaagaaatttttgctcaattaggtatcagcgatgaaattgacttaacaaccttgagc
tttgctgatcttaagggaggcgttaaggtggctgaaaagggtcaaccaattttcccacgt
ttggatagtgaagttgaggttaacttcattaaggaacaaatgacaaagtctgataaggca
aagggaagagcagcaatgaaagaagctgctgaaaacacttttgatccggaatccactgaa
ctgaagtcagataagaaggaagttcgctttgaagccttcgaaaaaattgaattaaaggtt
gcccaaatcaagagcgttaacaaagttgaaggtgctgataagttacttcaatttagactc
gacgctggagatgatggtgatcgccaaattctttcagggattgctcaatggtaccctgac
tatgaaaagttagttggtaaaaaagtaattattgttggtaacttgaaaccacggaagatg
aagggcgaagttagccaaggaatgttgctatctgtcgaacatgataacggcgacgttgaa
ttggttacaattcctgacaaccttcccaatggttcaactttagaataa

DBGET integrated database retrieval system