KEGG   Lactobacillus curvatus: FBA2_04900Help
Entry
FBA2_04900        CDS       T04808                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
lcv  Lactobacillus curvatus
Pathway
lcv00670  One carbon pool by folate
lcv01100  Metabolic pathways
lcv01120  Microbial metabolism in diverse environments
lcv01200  Carbon metabolism
Module
lcv_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lcv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    FBA2_04900
Enzymes [BR:lcv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     FBA2_04900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: ANJ69353
Position
complement(979857..981530)
Genome map
AA seq 557 aa AA seqDB search
MSDIQIAQENEAKEMQPITAIAEQAGLTAADLEQYGPYKAKVNFAAINRLKEKEDGKLIL
VTSINPTPAGEGKSTVTVGLGDALRQLDQSAVIALREPSLGPVMGMKGGATGGGYAQVVP
MADINLHFTGDMHTLTAAVNTLAALIDNHLQQGNALNIDPRRIIWKRALDINDRALRQVV
IGLGGPVQGVPRQDGFDITVASELMAILCLATDITDLKRRISQIVIGYTYDRQPVTVGEL
EITGAIAMLLKDALKPNLVQTLEHTPALIHGGPFANIAHGCNSILATQTALKMGDIAITE
AGFGADLGAEKFLDIKVPQLGKTPDTIVIVATVRALKYNGGVALADLTTENLGALDKGFS
NLAKHIANMQRYGIPVVVAINEFTSDTEVEVTMLQEKCAELGVKAVLASVWAHGGKGGLD
LAQAVLEALDQPKNFQPLYDSNADIQSKLTTIVTDIYGGKEVVFEGKAINQLKEIEKNGW
DHLPVCIAKTQYSLSDDPKALGAPTDFTVHVRELIPKLGAGFIVAMTGTVLTMPGLPKKP
AALNMDVTEDGLISGLF
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatattcaaatagcacaggaaaatgaagctaaggagatgcagccaatcacggca
attgccgaacaagctggtttaacggccgctgatttagaacaatatggaccgtataaagcg
aaggttaatttcgctgccattaatcgattgaaagaaaaagaagatggcaaactcatctta
gtgacctcaatcaatcccacaccagctggagaaggtaaatcaaccgtgactgtcggtctt
ggcgacgcccttcgtcaactagatcaatcagccgtcattgctttacgtgaaccttcacta
ggccccgtcatggggatgaaaggtggcgcaactggtgggggctatgcccaagtagtacca
atggcagatattaacttacattttacaggggatatgcacacattgaccgctgctgtgaat
actttagccgccctaatcgataaccatctgcaacagggaaatgccctcaacattgatccc
cgccgaattatttggaaacgggcgcttgatattaatgatcgtgcattacgccaagttgtc
attggacttggtggtccagtgcaaggggtgccgcgccaagatggttttgacattaccgtt
gctagcgaattaatggccattctctgcttagcaactgacattactgacttgaagcggcgc
attagccaaatcgtcattggttacacttatgatcggcaacccgtcacagttggcgagctc
gaaatcaccggtgcaatcgcgatgcttttaaaagatgccctcaaaccaaacctcgtccaa
acgcttgaacatacaccagccttaattcacggtggaccatttgccaatatcgcccacggc
tgtaacagtattttagcaacccaaacggccctaaaaatgggtgatattgcgattactgaa
gctggcttcggcgctgacttaggtgctgaaaagttcctagacatcaaagtcccacaactt
ggcaagactcctgataccatcgtgattgttgccactgttcgggcgttaaaatacaacggt
ggtgttgctttagctgatttaaccactgaaaatctcggtgcgttagacaaagggtttagt
aacttagccaaacatattgctaatatgcaacgttacggcattcccgtagtcgttgccatc
aatgagtttacaagtgataccgaagtagaggttacaatgctccaagaaaaatgtgctgaa
ctgggtgtcaaagccgttttagctagtgtttgggcacatggtggtaaaggtggccttgat
ttagcccaggccgtcttagaagcactcgatcaacctaaaaacttccaaccattatatgat
tcaaacgccgacattcaatcgaaactaaccacaattgtcactgacatctatggcggtaaa
gaggttgttttcgagggcaaagctatcaaccaactgaaagaaatcgaaaaaaatggctgg
gaccacttaccagtctgtatcgccaaaacacaatattcactctcagacgatccaaaagca
ttaggcgcaccaactgatttcaccgttcacgtccgtgaattgattccaaagcttggcgca
ggcttcatcgtcgcaatgaccggcacagtcctcaccatgccaggtctaccaaagaaacca
gccgccctcaacatggacgtcacagaagatggcctgattagcggattattctag

DBGET integrated database retrieval system