KEGG   Lactobacillus curvatus: FBA2_07450Help
Entry
FBA2_07450        CDS       T04808                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lcv  Lactobacillus curvatus
Pathway
lcv00071  Fatty acid degradation
lcv00072  Synthesis and degradation of ketone bodies
lcv00280  Valine, leucine and isoleucine degradation
lcv00362  Benzoate degradation
lcv00380  Tryptophan metabolism
lcv00620  Pyruvate metabolism
lcv00630  Glyoxylate and dicarboxylate metabolism
lcv00640  Propanoate metabolism
lcv00650  Butanoate metabolism
lcv00900  Terpenoid backbone biosynthesis
lcv01100  Metabolic pathways
lcv01110  Biosynthesis of secondary metabolites
lcv01120  Microbial metabolism in diverse environments
lcv01130  Biosynthesis of antibiotics
lcv01200  Carbon metabolism
lcv01212  Fatty acid metabolism
lcv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lcv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FBA2_07450
   00630 Glyoxylate and dicarboxylate metabolism
    FBA2_07450
   00640 Propanoate metabolism
    FBA2_07450
   00650 Butanoate metabolism
    FBA2_07450
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FBA2_07450
   00072 Synthesis and degradation of ketone bodies
    FBA2_07450
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FBA2_07450
   00310 Lysine degradation
    FBA2_07450
   00380 Tryptophan metabolism
    FBA2_07450
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FBA2_07450
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FBA2_07450
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FBA2_07450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcv04147]
    FBA2_07450
Enzymes [BR:lcv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     FBA2_07450
Exosome [BR:lcv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FBA2_07450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III CPSase_sm_chain
Motif
Other DBs
NCBI-ProteinID: ANJ69816
Position
complement(1477873..1479075)
Genome map
AA seq 400 aa AA seqDB search
MQEVVIISAKRTPIGKLGGQLASLSAVELGTVAAKAAIEAAGIDPTQIDQAIFGNVLQAG
SGQNVARQIALKSGMTQSSTAMTVNEVCGSGLKAIRLAQSAIVMGDADIVLVGGTESMSQ
APYLNKQMRFGSKFGDQTMIDSISSEGLNDAFTHQPMGITGENVAAKYGVTREMQDAFAL
ASHQKAAQATQAGWFNEEIVPVTVQQRKATLEVQQDEGIRPTTTIEAMAKLRPAFQQDGT
VTPANASGINDGASAMIVMSKEKAAALELVYQATLVGYQEVGADPDYMGYTPVDAIQKLL
AQQNQTLADIDLLEINEAFAASSVAVQNGLQVDPAKVNVAGGAIALGHPIGASGTRIMTT
LMHQLKRTHQTTGIASLCIGGGLGIAFEIQLNEAWCNEKA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagtagttattatcagtgcaaagcggacaccgattggtaaattggggggccaa
cttgcaagtttaagtgcggttgaattggggacagttgctgctaaagcggcgattgaagca
gccgggattgatccaactcagattgatcaagcaattttcgggaatgtcttacaagccggt
tctgggcaaaacgttgcacggcaaatcgctttgaagagtgggatgacacaatcaagcaca
gcaatgacagttaatgaagtttgtggttccggcctaaaagcaattcggttggcgcagagt
gcaatcgtcatgggcgatgctgacatcgtcttagttggcggtacagaaagtatgtcacaa
gcgccttatttgaataaacaaatgcgttttgggagtaaatttggggatcaaacaatgatt
gatagcatcagtagcgaagggttaaacgatgcgtttacgcaccagccaatggggattaca
ggcgaaaatgtagcagctaaatacggcgttacgcgtgaaatgcaagacgcttttgcactc
gcttctcatcaaaaagccgcgcaggcgacccaagctggttggtttaatgaagaaattgta
cctgtaacggtgcaacaacgcaaagcaacgcttgaagtacaacaagatgaaggtatccgc
ccaacgacaaccatcgaagcaatggcgaagttgcgcccagcttttcaacaagatgggact
gtaacacctgccaatgcttccggcattaacgatggcgcttctgccatgatcgttatgagc
aaggaaaaagctgctgcactcgaattagtttaccaagccactttggtcggctatcaagaa
gtcggtgctgatccagattacatggggtacacgccggtcgatgcaattcaaaaattatta
gcgcaacaaaatcaaacattagccgatatcgatttattagaaattaacgaagcgtttgcc
gcttcaagtgtggccgttcaaaatgggttacaagtcgatcctgctaaagttaatgtggcc
ggtggcgctattgcgttgggccatccaatcggtgcttcaggcacgcgcatcatgacaacg
ttaatgcaccaattgaaacggacgcaccaaacaacagggattgcttcgttatgtattggt
ggcgggttaggaattgcttttgaaattcaattaaatgaggcatggtgtaatgaaaaagcc
taa

DBGET integrated database retrieval system