KEGG   Lactobacillus casei W56: BN194_05200Help
Entry
BN194_05200       CDS       T02337                                 

Gene name
bglH
Definition
(GenBank) Aryl-phospho-beta-D-glucosidase BglH
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lcw  Lactobacillus casei W56
Pathway
lcw00010  Glycolysis / Gluconeogenesis
lcw00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lcw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN194_05200 (bglH)
   00500 Starch and sucrose metabolism
    BN194_05200 (bglH)
Enzymes [BR:lcw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BN194_05200 (bglH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase TraD_N
Motif
Other DBs
NCBI-ProteinID: CCK21467
UniProt: K0N223
Position
complement(510295..511725)
Genome map
AA seq 476 aa AA seqDB search
MKQRFPENFLWGASTSAYQVEGAAITHGKGLSQQDFINNNRSEKFGFADTSIASDHYHHF
KEDIRLFKEMGFTSYRFSIAWSRIFPKGDHQVNEEGLQFYRDLIAELKANDIEPIPTLYH
YDLPWALVEKYEGWLSREVVEDFGYFAKFVVNEFKNDVKYWITINEQSIIVQYWTQKCYV
PEKYQNQNQLRYQINHHMNLAQALAVKYIHEVGGLAGPALGYAPVYARTCKPEDQLAALN
ANDLRNFYYLDVYFKGYYTDAAFNYLKQHQLAPEIFDDDETLFSQNISDFLAVNYYDSQC
AHACPEGADHAWSGYNLTGKKGDMSGFETHPGFYQMCPNPELRTTDWDWAIDPIGLEIVY
RDLYTRYRIPFMITENGLGARDELTSDGKVHDDYRIAYLREHIAATQRAMGLGVQVLGYM
PWSALDLLSTSNGYNKRYGLIYVDRTDDDPKTCQRIKKDSFNWYKKVIASNGTDLS
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcgttttccagagaatttcctttggggtgcttcaacaagtgcctaccaagtc
gaaggtgccgcgatcacccacggcaagggcctttcgcaacaagattttattaacaataac
cgatctgaaaagtttggctttgccgatacaagcatcgctagtgaccactatcaccacttc
aaagaagatatccgcttatttaaagaaatgggttttactagctatcgtttttcaattgct
tggtcgcggatttttccaaaaggcgatcatcaggttaacgaagaaggtttacaattttat
cgcgatttgattgctgaactcaaagcaaacgatatcgagcccatccctactttgtatcat
tacgacctgccttgggctttggttgaaaaatatgaaggctggttatctcgcgaggttgtc
gaagactttggctattttgccaagtttgtggtcaatgagttcaaaaatgatgtgaagtac
tggatcacaatcaatgaacagagcatcatcgtccaatattggacccagaagtgttatgta
cccgaaaagtatcaaaatcaaaaccaattgcgttatcagatcaatcatcatatgaacctc
gcccaggcattagccgtgaaatatatccacgaggtcggtggtttggcaggcccagcatta
ggctatgcgccagtttacgctcgcacctgcaagcctgaggatcagctggcggccttgaat
gccaacgacctccgaaatttctattatcttgacgtgtattttaaaggttattacaccgat
gctgccttcaattatttgaagcaacatcagttggcacccgaaatctttgacgacgatgaa
accctcttttcacaaaacatctccgattttcttgctgtcaactattatgacagtcagtgc
gctcacgcttgtcctgaaggtgctgatcatgcttggtcagggtataacttaactggcaaa
aaaggtgacatgtcaggatttgaaacgcatcctggtttttaccaaatgtgtcctaatccc
gaactgcggacaactgattgggactgggccattgatcccattgggttggagattgtctat
cgcgatctttatactcgctaccgcatcccgttcatgattaccgaaaacgggctaggtgca
cgcgatgagctcacaagtgatggcaaagtgcatgatgactatcggattgcttacttacgc
gagcatattgccgccacgcaacgcgccatgggtctcggtgtgcaggttttaggctacatg
ccatggtcggctttagatttgctttctacaagcaatggctacaacaaacgttacggcttg
atttatgttgatcgaaccgatgacgatcctaagacatgccagcgcattaagaaagattcc
ttcaactggtacaaaaaagtaatcgcctcaaatggtactgatctcagttga

DBGET integrated database retrieval system