KEGG   Lactobacillus casei W56: BN194_07530Help
Entry
BN194_07530       CDS       T02337                                 

Gene name
sbcD
Definition
(GenBank) Nuclease sbcCD subunit D
  KO
K03547  DNA repair protein SbcD/Mre11
Organism
lcw  Lactobacillus casei W56
Brite
KEGG Orthology (KO) [BR:lcw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lcw03400]
    BN194_07530 (sbcD)
DNA repair and recombination proteins [BR:lcw03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BN194_07530 (sbcD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SbcD_C Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: CCK21700
UniProt: K0N6B1
Position
744290..745411
Genome map
AA seq 373 aa AA seqDB search
MRFLHTADWHIGKKLNDFDLLEDQQAVFEQLVETAETHKVDAIVIAGDLYDRALPSEAAV
SVLDNMLIKLNRDHGYPLLVISGNHDSAVRLRTGRAWYAATKMFVNTQVAEAFTPIELDG
VQFFLLPYFEPFAVRDYFQDKTITNVAQAIRPIVAKMKTLFKPDMRHILVSHFFAAGSDH
SASETKVNVGGLDAVPLDDLAAFDYVALGHLHNHHALHGEPKIQYSGALLKYAVSEAHQE
KGVYIVDTETMDREFVPLKPKHDLIELKASYADLTAPAYYQQQDRDAYIGIDLTDTQVIP
NVMAQLRQIYPRIISLRRENGVNAIKPLQERQRDLDPMSLLQTFFKDMTQDDLSAAQIKW
AKAGLTTAKKEQA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgagattcttacacacagccgattggcatattggcaaaaaactaaatgattttgatttg
cttgaggatcaacaagctgtgtttgaacagctggtggaaacggctgagacgcataaagtt
gatgccattgtcattgcgggggatctctatgaccgcgccttgccaagcgaagctgctgtt
tccgttctggataacatgttgattaagttgaatcgtgaccacggctatccgttgctggtc
atttcaggcaaccatgactcggcggtacgcctgcgcacaggtcgggcatggtatgccgct
actaaaatgtttgttaatacccaagtagccgaagcttttacacccattgagttggatggc
gtgcaattctttttgctgccgtattttgaaccctttgctgttcgtgactattttcaagat
aagacaatcacgaatgtggctcaggcaattcgcccgattgtcgcgaaaatgaagacttta
tttaagccagatatgcgtcatattctggttagtcattttttcgctgctggaagtgaccat
agtgcttcggaaacgaaagttaatgttggtggactggacgcggtaccgctggatgatttg
gcagcatttgattatgtggcactagggcatctgcacaaccatcatgctttgcatggtgaa
ccaaagattcaatatagcggtgctttgttaaaatacgcggtcagcgaggcccatcaagaa
aaaggggtctatattgtcgatactgagaccatggatcgtgagtttgtgccgttgaagcct
aagcacgatttaatcgagttaaaagctagttatgccgacttgacggctccagcatactat
cagcagcaggatcgagacgcctatattgggattgatttgaccgatacgcaagtaattccg
aatgtcatggcgcaattacgccagatttatccgcggattattagcctgcgccgtgagaac
ggcgtgaatgccatcaagcctttgcaagagcggcagcgtgatttggatccgatgagtttg
ctgcagactttttttaaagatatgacacaagatgatttgtcggccgcccagattaagtgg
gcgaaggcagggttgacgacggctaaaaaggagcaggcataa

DBGET integrated database retrieval system