KEGG   Lactobacillus casei W56: BN194_07540Help
Entry
BN194_07540       CDS       T02337                                 

Definition
(GenBank) SMC domain protein
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
lcw  Lactobacillus casei W56
Brite
KEGG Orthology (KO) [BR:lcw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lcw03400]
    BN194_07540
DNA repair and recombination proteins [BR:lcw03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BN194_07540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 SbcCD_C SMC_N AAA_29 AAA_21 ABC_tran AAA_22 AAA
Motif
Other DBs
NCBI-ProteinID: CCK21701
UniProt: K0MTC3
Position
745411..748536
Genome map
AA seq 1041 aa AA seqDB search
MQLKQLHMQFFGPYADAVVDFDDFRTSPLFLISGPTGSGKTTIFDALIYALYGETSGERD
GGQMRSNFAGNSDLTKVTLTFDHDGKHYLIERQPPQLQSKKRGDGLTEVKAKVLLAISSD
EKQVAEYRKKNQVQEQLDAVLHLDASQFRQIVLLPQGDFRRFLDADSNAKEDLLRDLFGT
QLIQRWQTAMLAQMKAKGAAIQDQERMLDVLMSQFDFETAPDEHATMADKLSLMRATVAS
QAKVVTARQATAAQSHQRYQEAQTALQQGQQLAQAFTEREQAATALAKLAEQKQTHQKQL
KQIEQLTWVQQHENAAQRVQKAGQDLKAAIVQSEQTQAALTTTEQKFSLDKQALARLQAK
SDQIEAQKKQLNSLQAVQQQLTAIAEQNKQVIKQAAIVNEAELALTHAQQQLTDAQTVKT
QQQTSLDNLGLDELITTVNTQRNLLAALVPQAANYQEAQADVAQLSMAIKKTQVTLEQAE
TQVAVTTSHLNKLQQTQIRQQIAHLAAKLEPDSPCPVCGSTSHPHPALVVDEPLVSEAAL
KQADQERQKAAARKTMVETQLANLETQLKTAKAKTAQARQAFTEHWQEQAKLIAGVADKT
GILQQLTALKTLAATNEHQLTEAQTEHAALQVALKKSDKAITTGTTKVQQCEASLNTARI
DAAEAQSALKTMQKNLPAEATDLASVAAQVTTLQTTITTYQDQLQEAQARVNALDRQLAG
LQADEKHAAAQVTALTKEQAEAKATFTIAVTQYFGADGKQRFAELQLRVSQLPLLNEQVQ
TYEHTQLKQQTLLDAANKTIGTQAQPQLDQLEAEATAAETTATNDQTALIKISQAHDAAE
KLVKQAATIFTANQTALAAYADLQTLATVMNGNGPKKLSLERYVLQAYLQEILNVANSRL
QVLSNNRYQFVLHTSLGTQKIHSGLEIDVYDDQVGEKRAVQTLSGGESFIAALSLALALG
EVIQQESGGINIDALFVDEGFGSLDANSLDVAMNALESLEGESRLIGIISHVTELRDNIP
DQLQVEPAGTGRSHLKIVHSA
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttaaacaattacacatgcaattttttggtccgtatgcagatgcagtcgttgat
tttgacgattttcgcaccagtcccttattcttgatcagcgggccgaccggcagtggtaaa
accacgatttttgatgctttgatttatgccttgtatggtgaaacgtcaggtgagcgtgac
ggtgggcaaatgcgctcaaattttgcaggtaacagcgatttaacaaaggtgacactcacc
tttgatcatgatggcaaacattatttaatcgagcgccaaccgccgcaattgcaaagtaaa
aaacgcggcgatggactaaccgaagtcaaagctaaggtgttgctagctatctcctcagat
gaaaaacaggtggctgagtaccgtaagaaaaatcaagttcaggaacagctagacgccgtt
ttacaccttgatgcttcgcagtttcgacagattgttttgttgccacaaggcgattttcgc
cggttcttagatgctgatagcaatgcgaaagaagatctactgcgtgacttgttcggtact
cagttgattcaacgttggcaaaccgctatgttggcgcagatgaaggccaagggagcagcc
attcaggaccaagagcggatgttagacgttttgatgtcgcagtttgacttcgagacggct
cctgacgagcatgctacgatggcggataagctgtcattgatgagagcaacggtggcgagt
caagcgaaagttgtgacagcaagacaagcgaccgcggcgcaaagtcaccaacgatatcag
gaagcacaaacggcactgcaacaggggcaacaattggcgcaggcttttacagagcgagaa
caagccgccacagctttagcaaaactggcggagcaaaaacaaacccatcagaagcaatta
aaacaaattgaacaattgacatgggtacagcaacatgaaaatgctgcccaacgcgttcaa
aaggctggacaagatcttaaagcggcaattgtgcagtctgaacaaacgcaagcagcttta
acgacgaccgaacagaaattttctctggacaagcaagctttagcacgcttgcaggccaaa
tcagaccagattgaggcccaaaagaaacaactgaatagtttacaggctgttcagcaacag
ttgacagccatcgccgaacaaaataaacaggtgattaaacaagcagcgattgttaatgag
gctgagcttgcgttgacgcacgcacaacagcagttgacagacgcccaaactgttaaaaca
cagcagcaaacaagtctggataacttgggcttggatgagctgataaccacggtcaatact
cagcgcaacttattggctgccttagtgccacaggctgctaattatcaggaagcccaagct
gatgttgcgcagttgtctatggccatcaaaaaaacccaagttacgctggagcaagccgaa
acgcaggtagcagtcacaacctcgcatttgaacaagcttcagcagactcagattcgccaa
caaattgcacatttggctgctaagctcgagcctgacagcccatgtcctgtttgcggcagt
actagccatccgcatccggcgcttgtggttgacgaaccattggtgagcgaagcagcgttg
aaacaagccgatcaggaacggcaaaaggctgccgcaagaaaaactatggtcgagacacaa
ttggcgaatcttgaaacccaactgaaaactgcgaaggccaaaaccgcacaggcaaggcag
gcttttactgagcattggcaagaacaggccaaactgattgcaggcgttgcggataaaact
ggtattttacaacaattaacggcgttgaaaacactggcggcaactaacgagcaccagtta
acggaagcgcaaacggagcacgctgctttgcaagttgcgctaaaaaagagtgacaaggcc
atcactaccggtacgacaaaagttcagcaatgcgaagctagtttgaatacggctagaatt
gatgcggctgaagcgcaaagtgcgttgaagaccatgcaaaagaacctgcccgcggaagcg
actgatttggcgtcggtcgctgctcaagttacaaccctgcagacaaccattacaacgtat
caggatcaacttcaggaggcgcaggcaagggtcaatgctttggaccggcaattagccggg
ttgcaagcagacgagaaacacgccgcggcacaagtgactgctttgaccaaggaacaggcg
gaagcaaaagcaacctttacgatagcagtcacgcagtattttggtgctgatggcaagcaa
cggttcgccgagttgcagctgcgggtatcacaattaccgctattgaacgaacaggttcag
acttatgagcatacacagctcaagcaacaaacgttattagatgccgccaataaaactatt
ggtacccaagcacagccacagcttgatcagctcgaggccgaagcaacagcagcggaaacg
acagcaacaaacgaccaaacggctttgattaagattagtcaggcgcatgatgctgctgaa
aaattggtcaaacaagccgccactatctttacggccaatcaaacggcgcttgcagcctat
gcggatttacaaacactggccactgtgatgaatggcaatggtcccaagaaactcagtctg
gagcgatacgttttgcaggcttatttgcaagaaattctgaatgtggccaatagccgtctg
caggttttgtccaataaccggtatcaatttgttttgcatactagtttgggaacgcagaaa
attcattctggcttggagattgatgtttacgatgatcaggtaggagaaaagcgtgccgtg
cagacgctatcgggcggcgaaagcttcatcgctgcgctcagtctggcattggcgttaggc
gaagtgattcagcaggaaagcggcggcattaacattgatgcgttgtttgttgatgaaggc
ttcggcagccttgatgccaatagtcttgatgtggcgatgaatgcgttggagtcgctagaa
ggtgaatcgcggctgattggcatcatctcccatgtgaccgagttgcgggataatattcct
gaccagttgcaagttgagccagcaggtacgggccgcagccacttgaagatcgtccactcg
gcttag

DBGET integrated database retrieval system