KEGG   Lactobacillus casei W56: BN194_08160Help
Entry
BN194_08160       CDS       T02337                                 

Gene name
ndk
Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
lcw  Lactobacillus casei W56
Pathway
lcw00230  Purine metabolism
lcw00240  Pyrimidine metabolism
lcw01100  Metabolic pathways
lcw01110  Biosynthesis of secondary metabolites
lcw01130  Biosynthesis of antibiotics
Module
lcw_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
lcw_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
lcw_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:lcw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BN194_08160 (ndk)
   00240 Pyrimidine metabolism
    BN194_08160 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lcw04131]
    BN194_08160 (ndk)
Enzymes [BR:lcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     BN194_08160 (ndk)
Membrane trafficking [BR:lcw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    BN194_08160 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: CCK21763
UniProt: K0N340
Position
complement(807536..808018)
Genome map
AA seq 160 aa AA seqDB search
MKIVKETRHTHMAEEQTLVLVKPDGVANGHIGDVITRIEHRGFTIDALKVTHATADQLHQ
HYAALVGEPFFPRIERFMTGGPMVAMIVSGFNVIEAVRKMTGATNPAEAAPGTIRGDFGR
EWADKTIRNVIHSSDSETSARREIPIWFPDRQYAPHQPEK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
ctgaaaatagttaaggaaacgaggcacacacacatggcagaagaacaaactttagtcttg
gtcaaaccggatggtgttgcaaacggacatattggggatgtgatcacgcggattgaacac
cgcggcttcacaattgatgcgctgaaagtcacacatgcaacggcagatcagttacatcaa
cattacgcagcacttgttggcgagcctttctttccaagaatcgaacgcttcatgacgggc
ggtccgatggtggcaatgatcgtgagcggcttcaatgtgatcgaagcggtgcgtaaaatg
acaggcgccacgaatcccgccgaagcagcgcccggcacgattcgtggagattttggccgt
gaatgggccgacaaaactattcgcaatgtcattcacagttccgatagtgagacgagtgcc
cgacgtgaaattccaatctggttccctgatcgtcaatacgcccctcatcagccagaaaaa
tag

DBGET integrated database retrieval system