KEGG   Lactobacillus casei W56: BN194_08360Help
Entry
BN194_08360       CDS       T02337                                 

Gene name
ruvB
Definition
(GenBank) Holliday junction ATP-dependent DNA helicase RuvB
  KO
K03551  holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
lcw  Lactobacillus casei W56
Pathway
lcw03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lcw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BN194_08360 (ruvB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lcw03400]
    BN194_08360 (ruvB)
Enzymes [BR:lcw01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BN194_08360 (ruvB)
DNA repair and recombination proteins [BR:lcw03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BN194_08360 (ruvB)
    RecFOR pathway proteins
     BN194_08360 (ruvB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvB_N AAA_lid_4 RuvB_C AAA AAA_5 Mg_chelatase TIP49 Sigma54_activat AAA_16 AAA_14 DUF815 AAA_22 AAA_3 NB-ARC AAA_24 TsaE NTPase_1 Rad17 AAA_25 AAA_18 Bac_DnaA RNA_helicase IstB_IS21 Sigma54_activ_2 NACHT AAA_33 ATPase_2 Torsin AAA_11
Motif
Other DBs
NCBI-ProteinID: CCK21783
UniProt: K0N353
Position
824623..825639
Genome map
AA seq 338 aa AA seqDB search
MADADKDRLVSGDVDDSNEAQIEKSLRPRMLAQYIGQDRVKHQLEVYITAAKQREESLDH
VLLYGPPGLGKTTLALVIANELGVNIRTTSGPAIEKPGDLVALLNELHPGDVLFIDEIHR
LPKIVEEMLYSAMEDFYIDIVVGQGPTAHPVHFPLPPFTLIGATTRAGMLSAPLRDRFGI
SEHMAYYSADDLSEIVKRSATIFDMAIDAEGAHEIARRSRGTPRVANRLLKRIRDFAEVA
GQSPVDIQMVDHALDQLQVDQQGLDQIDRKLLMFMIRDYEGGPVGLSTIAANIGEEMATI
EEMYEPYLLQIGYLKRTPRGRMVTPAGFAHMGMSAEQH
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
ttggcagacgcagacaaggatcgcttggtttctggcgacgttgacgattcgaatgaagca
cagatcgaaaaaagtttacgtccccggatgctcgcgcagtatattggtcaggatcgcgtc
aaacatcagttggaagtctatatcacggctgccaaacagcgcgaagagtcattggatcat
gttctgctctatggaccgcctggtttgggaaaaacgacgttggctttggtgattgccaat
gaactgggcgtcaatattcgcacgacatcagggcctgctatcgaaaaaccgggtgattta
gtggcactgctgaatgaattgcatcccggtgatgtcttgttcattgatgaaattcaccgt
ctaccaaaaattgtcgaagaaatgctttattcagcgatggaagatttttatattgatatt
gtggttggtcaagggccaaccgcccaccctgtgcatttcccgcttcctcccttcacctta
attggggcgacaacgcgcgctggcatgctttccgctccgttacgtgatcgatttggcatc
agtgaacatatggcgtattattctgctgatgacctcagtgagatcgtcaaacgatcagca
acaattttcgatatggcgattgatgctgaaggtgctcatgaaattgcccgacggtcgcgg
ggaacaccgcgggttgctaatcggctgctcaaacgtatccgtgattttgccgaagttgcg
gggcagagtccagttgatatacaaatggttgaccatgcgcttgaccagctgcaagtcgat
cagcaaggcttagaccaaattgatcgcaaactgttgatgttcatgattcgtgattacgaa
ggcggccccgttggactctcaacgattgccgctaacatcggcgaggaaatggcaacgatt
gaggaaatgtatgagccttatctgttacagatcgggtatttgaaacgaacgccgcgtggc
cgcatggtgacgccagccggatttgcacatatggggatgtcggctgaacaacattag

DBGET integrated database retrieval system