KEGG   Lactobacillus casei W56: BN194_10080Help
Entry
BN194_10080       CDS       T02337                                 

Gene name
recA
Definition
(GenBank) Protein RecA
  KO
K03553  recombination protein RecA
Organism
lcw  Lactobacillus casei W56
Pathway
lcw03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lcw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BN194_10080 (recA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lcw03400]
    BN194_10080 (recA)
DNA repair and recombination proteins [BR:lcw03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BN194_10080 (recA)
    RecFOR pathway proteins
     BN194_10080 (recA)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    BN194_10080 (recA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecA Rad51 ATPase ATPase_2 AAA_24 AAA_25 AAA_16 AAA ABC_tran CobU AAA_14 AAA_35
Motif
Other DBs
NCBI-ProteinID: CCK21955
UniProt: K0N6W2
Position
995061..996122
Genome map
AA seq 353 aa AA seqDB search
MAGDERQKALDVALKKIEKNFGKGAIMRMGAKADTRVSVVSSGSLAVDDALGVGGFPRGR
IVEIYGPESSGKTTVALHAVAEVQKQGGTAAYIDAENAMDPKYATALGVNIDELLLSQPD
TGEQGLEIADELVASGAIDIVVIDSVAALVPRAEIEGDMGDAHVGLQARLMSQALRKLSG
SINKTKTIALFINQIREKVGIIFGSPETTPGGRALKFYATVRLEIRRSEQIKTGADVVGN
RTKIKVVKNKVAPPFRTAIVDIMYGQGISQTGELVDMAVERDIVEKAGSWYAYQGERIGQ
GRENAKTYLDNHADLQQTIKQQVRVAYGMAAAPGRETASVSEDQPEIHQQAEV
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagacgaacgccagaaagcattggatgttgcactgaaaaagattgaaaaaaat
tttggtaaaggcgcgattatgcgaatgggtgctaaggcggacacgcgcgtttccgttgtc
tctagcggctcacttgccgttgatgatgcacttggtgttgggggctttccgcgcggacga
attgtcgaaatttatggaccggaaagttccggcaaaacaaccgtcgcgctgcatgctgtt
gctgaagtgcagaagcaaggcggtactgccgcctatattgatgccgagaatgcgatggat
cccaagtacgcaactgctttgggcgtcaatattgacgaattattgctctcccagccagac
acaggcgaacaagggctggagattgctgatgaactagtcgcgtctggtgccattgatatt
gtggtgattgattcagttgctgctttggtgccgcgggctgagattgagggcgatatgggg
gatgcccatgttggcttgcaagcccgattaatgtcacaggcgttacgtaagttatccggt
tccatcaataagacaaaaacgattgctttattcattaatcagattcgtgagaaagtcggg
atcatttttgggagtccggaaacgacaccaggtggtcgcgcattgaagttttatgcgact
gttcggttagaaatccggcggtcggaacagatcaagacaggcgcagatgtcgtcggcaat
cgcactaaaatcaaagtggtcaagaataaggtggcaccgccttttcgaacagcaattgtg
gatatcatgtatggccaaggcatttcgcaaactggcgaacttgtcgacatggccgttgag
agagatattgttgaaaaagcagggtcatggtacgcgtatcaaggtgaacgcatcggccaa
ggtcgcgaaaacgctaagacatatcttgataaccacgctgatcttcagcagacgattaaa
caacaggttcgcgtggcttatggtatggcagccgcacctggtcgggagacggcttcggtc
agtgaagatcaacccgaaatacatcaacaggctgaagtatga

DBGET integrated database retrieval system