KEGG   Lactobacillus casei W56: BN194_18070Help
Entry
BN194_18070       CDS       T02337                                 

Gene name
priA
Definition
(GenBank) Primosomal protein N'
  KO
K04066  primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:3.6.4.-]
Organism
lcw  Lactobacillus casei W56
Pathway
lcw03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lcw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BN194_18070 (priA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lcw03400]
    BN194_18070 (priA)
Enzymes [BR:lcw01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     BN194_18070 (priA)
DNA repair and recombination proteins [BR:lcw03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BN194_18070 (priA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PriA_3primeBD PriA_C ResIII DEAD PriA_CRR Helicase_C PIF1 Zn_ribbon_SprT AAA_19 TrwB_AAD_bind zinc-ribbons_6 zf-ISL3 DUF2075 AAA_30 T2SSE zf-CHY
Motif
Other DBs
NCBI-ProteinID: CCK22754
UniProt: K0NB43
Position
complement(1786212..1788629)
Genome map
AA seq 805 aa AA seqDB search
MAIVAKVIVDVPTMQTDRPFDYLVPARLEGALQAGMRVWVQFGKGARKVSGMVVSVSDQS
DYDGQLKPLLDVLDPAPVLDHELLKLSKWLAQTTYSFWIACMQTMLPTMLKIDAVKVAEP
VKLTADEQQKYFGTADSLAIGSLNAEQQVAVMKLAQAGKVAISYLKKDRARVKKIFYLIP
QLSLEQAAAEREHVRKNAAKQLKLLTLIGEWAANNQHPALMTVEHQYGLTKPVINQAVEK
GWLKLEGHETYRDPYPELQHQPLTKPLPLTPEQQTIVTQINAAVAERDPKTFLLEGVTGS
GKTEVYLQVIAQVLAAGQTALMLVPEIALTPQMVNRVKGRFGTHVAVMHSGLSDGEKYDE
WRRIARGEAQVVVGARSAAFAPLKNIGVFIMDEEHETSYKQDSAPRYHARDVLLKRAQIH
HAPVVLGSATPSLESRARAEKGVYTLLRLPHRINDQPLPPVHIVDMREAFAHGAQEDFSG
PLLDALRIRLQRQEQSVLLLNRRGYSSFVMCRDCGYVAKCPNCDISLTLHMDTHTLKCHY
CGHEEPIPHRCPNCGSDKIRYYGTGTQKVEAKLQQLLPDARILRMDVDTTRRKGGHARIL
DAFGDHQADILLGTQMIAKGLDFPDVTLVGVINADTALGLPDFRASEKTFQLLTQVSGRA
GRADKPGEVFVQTFNPDHYAIQYAKRQDYEGFFRQEMAIRHRGNYPPYFYSTKIAVSHVD
ETQAAKAIFSLAKELREHLSDQVIMLGPTPGPIARLKNRYIYQIVLKYKHEPALAATLQH
ILEETQQSSRHGFLVAIDPEPLAFV
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
ttggcaattgttgccaaggtgatcgtggatgtgcccacgatgcaaacagatcgaccgttt
gattatcttgtacctgcgcgcttagaaggcgctttgcaggcgggaatgcgggtctgggtc
cagtttggcaaaggtgcgcgaaaagtgagcggcatggtcgtgtcagtctccgaccaaagc
gactatgacggtcaattgaaaccattgttagatgtccttgatccggccccggttttggat
cacgaattattaaagctatcgaagtggttggcgcaaacaacgtattctttttggattgcg
tgcatgcagacaatgttgccaactatgttgaaaatcgatgcggtaaaagttgctgaaccg
gttaagctgacggctgatgaacaacaaaaatattttggaacggctgacagtctggcgatc
ggtagcttgaacgctgaacagcaagttgcagtgatgaaattggcgcaagcaggtaaagtt
gctatttcatatttaaaaaaggatcgtgctcgggttaaaaaaatcttttacttgatcccg
caattatcactggagcaagcggctgccgagcgtgaacacgtgcgtaaaaacgccgccaag
caacttaaactgttaactttaattggtgaatgggctgctaacaatcagcatcctgctttg
atgaccgttgaacatcaatatggcctgacaaagccggtgattaatcaggcagtcgaaaaa
ggctggctgaagcttgaaggccacgagacttaccgcgatccttatccggaactgcagcat
caaccgttgacgaagccgttgccgctcacgccagaacaacagacgattgtgacgcaaatt
aacgctgccgttgccgaaagggatcctaaaacatttttgttagaaggggtcaccggctct
ggcaaaacagaagtctatttgcaggtgattgcacaagttttagccgcgggacagacagct
ttgatgcttgtgccggaaattgcgttgacgccgcaaatggtcaatcgcgtaaaaggccgt
tttgggacgcatgttgccgtgatgcactctggcttgtctgatggcgaaaagtatgatgaa
tggcgccgaattgcgcgcggcgaggctcaggtcgttgtcggcgcacgatcggcagcattt
gcgccgttaaaaaacatcggcgttttcatcatggatgaagagcacgagaccagctacaaa
caagattcggcgccacgctatcacgcccgtgacgttttgttaaaacgggcacagattcac
catgcaccggttgtgttgggctcagcaacaccttcattggagtcgcgcgctcgagcggaa
aagggcgtttatacactgctgcggctgccgcatcggattaacgatcaaccattaccgcca
gtgcatattgttgatatgcgggaagcctttgcgcacggcgcgcaagaggacttttcgggc
ccgctgcttgacgccttgagaattcgactacagcgacaggaacaaagtgtgttgctcttg
aatcggcgcggttattcaagttttgtgatgtgtcgcgattgcggctatgtggcaaaatgt
ccgaactgtgacattagtctgacgctgcacatggacacacacaccttgaaatgtcattat
tgcggccatgaggaaccgattccacatcgttgcccaaactgcggttctgataaaattcgc
tattacggtactggcacccaaaaggtcgaggcgaagttgcagcagttgctgccagatgcc
cgaatcttgcgaatggatgttgataccactcggcgcaaaggtggccatgcgcggatctta
gatgcgtttggtgaccatcaggccgatatcttactgggtacgcaaatgatcgcaaaggga
ctggattttcccgatgtgactttagttggtgtcattaatgcggacacagcgctcggcctg
ccggattttcgggcgagtgagaagacctttcagttgctcacacaggtgagtggccgggct
ggtcgggcggacaaacccggtgaagtcttcgttcagaccttcaatccagatcattatgcc
attcaatacgccaaacggcaggactacgaaggctttttccggcaagagatggccattcgg
catcgcggcaattatccaccatatttttattcaacgaaaatcgctgtgagccatgttgat
gaaacacaggcggctaaggctatcttttctttggcaaaagaattacgtgagcatctatcc
gatcaggtcatcatgcttggcccgacaccaggaccgattgctcgtttgaaaaatcgctat
atttaccaaatcgttctaaaatataaacacgagccggcgttagcggcaaccctgcagcat
attttggaagagacccagcaaagcagtcgtcacggctttttagtcgcgattgatccagaa
ccgttggcatttgtttaa

DBGET integrated database retrieval system