KEGG   Lactobacillus casei W56: BN194_20290Help
Entry
BN194_20290       CDS       T02337                                 

Gene name
pycB
Definition
(GenBank) Pyruvate carboxylase subunit B
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
lcw  Lactobacillus casei W56
Pathway
lcw00620  Pyruvate metabolism
lcw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN194_20290 (pycB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lcw02000]
    BN194_20290 (pycB)
Enzymes [BR:lcw01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     BN194_20290 (pycB)
Transporters [BR:lcw02000]
 Other transporters
  Primary active transporters [TC:3]
   BN194_20290 (pycB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA 6PF2K AtuA
Motif
Other DBs
NCBI-ProteinID: CCK22976
UniProt: K0MWI8
Position
complement(2009601..2011103)
Genome map
AA seq 500 aa AA seqDB search
MGTSVMAGLWPLHLRFLHTGFWVSECVLKGGHPMPKQKVQFMETVLRDGQQSLIATRMPI
SDILPILDKMDAAGYASLEMWGGATFDACLRYLNEDPWERLRKIRKAVKHTKLQMLLRGQ
NLLGYKNYADDVVTDFVTKSVENGIDIIRIFDALNDTRNLRTALEATKQAGGHAQLAICY
TTSDFHTIDYFIKLAKDMADMGADSIAIKDMAGILTPQKAFDLVTGIKQEISVPLEVHTH
ATAGMAEMTYLEAVRAGADIIDTAVSPFAGGTSQPATESMLVALQDLGYPTDVDLSTVSD
IATYFAPIRDRFRESGQLNPRVKDVEPKSLIYQVPGGMLSNLLAQLKDQGQEALYGDVLK
EVPRVRADLGYPPLVTPLSQMVGTQSLMNVMSGERYKLIPNEIKDYVRGLYGRPPVAIAP
EMVKKIIGDAPVVTQRPADLIKPQMPEFRQAIAQYAHDEEDVLSYALFPDQAKDFLGRRE
DPFYDVPEQKVSLSFEPTHD
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtgggcacaagtgtgatggccgggctttggccattgcacttgaggttcttacacacaggt
ttctgggtcagtgaatgcgttttaaaaggaggacaccccatgcctaaacagaaagtccaa
ttcatggaaaccgttttgcgtgacgggcaacaaagcctgattgccacgcggatgccgatc
agtgatattttgccgattctcgataagatggatgctgccggctatgcatctttggaaatg
tggggcggggcaacttttgatgcctgtctccgttatctgaatgaagatccatgggaacgg
ttgcgcaagattcgtaaggcggtcaagcacaccaaattgcaaatgctcttgcgcgggcaa
aacttgttaggttacaagaactatgccgacgatgtggtcactgactttgtcacaaagtca
gttgaaaacgggattgatatcattcgtatttttgatgcgttgaatgatacacgcaacttg
cgaacggcgcttgaagcgacgaagcaagcaggcgggcatgcccaacttgctatttgttac
acaaccagtgatttccatacgatcgactacttcatcaagttagccaaagacatggctgac
atgggggcggattcaattgcaatcaaagacatggcaggcattttaaccccacagaaggcg
tttgatctggttaccggtattaagcaggaaatcagcgtgccactggaagtgcatacgcac
gccaccgctggtatggctgagatgacgtatctggaagcagttcgcgccggtgctgatatc
attgataccgcggtttcgccatttgctggcggcaccagtcagccagcaacagaatccatg
ctggttgcgttgcaagatcttggctatccgactgatgttgatttaagcacggtcagtgac
atcgccacttactttgcgccgattcgcgatcgattccgcgagtccggtcaactgaatccg
cgcgtgaaagatgttgagcctaaatccttgatctatcaggtgccaggcgggatgttgtct
aacctgttggcgcaactaaaagatcaaggacaagaagcgctttatggcgatgttttgaag
gaagtgccgcgtgtccgagctgacttaggctatccgccgttggttacaccgctgtcgcag
atggtgggcacacaaagtttgatgaatgtcatgagcggtgagcgttataagttgattcca
aatgaaattaaggattacgtgcgcggcctttatggtcggccgccagtggcaattgcaccc
gaaatggtgaaaaagatcattggtgatgcaccggttgtcacacaacgtcccgcggattta
atcaagccgcaaatgcctgagttccgtcaagcgattgcgcaatatgcgcacgacgaagag
gatgtcttaagctatgctttgttcccagatcaagctaaagattttcttggccgacgcgaa
gatccgttttatgatgtgccggagcagaaggtgtcgctaagttttgagccgacgcatgat
tga

DBGET integrated database retrieval system