KEGG   Lactobacillus casei W56: BN194_27650Help
Entry
BN194_27650       CDS       T02337                                 

Gene name
recA_2
Definition
(GenBank) Protein RecA
  KO
K03553  recombination protein RecA
Organism
lcw  Lactobacillus casei W56
Pathway
lcw03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lcw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BN194_27650 (recA_2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lcw03400]
    BN194_27650 (recA_2)
DNA repair and recombination proteins [BR:lcw03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BN194_27650 (recA_2)
    RecFOR pathway proteins
     BN194_27650 (recA_2)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    BN194_27650 (recA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecA Rad51 ATPase AAA_24 AAA ATPase_2 AAA_16 AAA_25 AAA_14 DUF2675 CobU AAA_35
Motif
Other DBs
NCBI-ProteinID: CCK23712
UniProt: K0N8P0
Position
complement(2771516..2772787)
Genome map
AA seq 423 aa AA seqDB search
MVWLSYCDQGAYIQTFAPVSAFKETSMAKKTTAKNDNTKSDATDRDTELEKALQKIKKAF
GEGAVMKMGDRPELKVDVVSTGILSLDLALGVGGLPRGRIVEVYGPESTGKTTIALQTIA
ELQKSGGKAAYIDAENAMDPKYAAELGVNIDDLLLSQPNSGEQGLEIAEMLIESAAVDIV
VIDSVAALVPKAEIEGAIGDSHVGLQARLMSQALRKMAGSINNTNTLVIFINQLREKVGV
MFGNPEVTPGGRALKFYASVRIEVKRGQQVKDGKDVVGFASKLKVTKNKVAPPFKSVETT
MSFGHGIEHNTDMINLATDKDNDIDVITKSGSWYNYGKERLGQGLVNASHYLDEHPEISK
EIEEKIREQVAPKKPEETDEKQDDKKDDQASADKKSENTTTTDTEKKADKKDDPASFGVD
RLV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggtctggttgagctattgtgaccaaggtgcttacatacagacttttgcgccagtgagc
gcatttaaggagacaagtatggctaagaaaacgaccgcaaagaatgataatactaaatct
gatgctacagatcgcgataccgaactagaaaaagcccttcagaagatcaagaaagccttt
ggtgaaggtgccgtcatgaagatgggcgatcgaccggaactgaaggttgatgtcgtctca
acaggcattttatccttggatcttgcactcggtgtcggcgggttaccgcgtggccgaatc
gttgaagtctatggtcctgaaagtaccgggaaaacaacgattgcgttgcagactattgcc
gaattgcagaaatcaggcggcaaggcggcttacattgacgccgaaaatgcgatggatccg
aagtatgcggcggaacttggcgtaaatattgacgacttactgttgtctcagccaaactct
ggggaacaggggcttgaaattgctgaaatgctgattgaatcagcggctgttgatattgtt
gtcattgactctgtcgcagccttggttcccaaggctgaaattgaaggtgccatcggggat
agccatgtgggcttgcaagcccggctgatgtcgcaggcactgcggaagatggccggttcg
atcaacaataccaatacgctggttattttcattaaccaattgcgtgaaaaagttggcgtg
atgtttggcaacccagaagtgacaccgggcggccgtgccttgaaattctatgcgtctgta
cggattgaagtcaagcgcgggcagcaggtgaaagacggcaaagatgttgtcggcttcgct
agcaaactgaaagtcactaagaataaggtcgcaccgccgtttaaatcggttgaaaccacg
atgtcatttggtcacgggattgaacacaataccgatatgattaacttggcaaccgataaa
gacaatgacattgacgtcatcaccaagtctggctcttggtataactatggcaaggaacgt
ttgggccaaggacttgtcaacgcatctcactacttggatgaacatccggaaatttctaag
gaaattgaagaaaagattcgtgaacaagttgcgccaaagaagcctgaagaaaccgatgag
aagcaggatgataagaaagacgatcaggcatctgctgataaaaagagcgaaaatacaacg
accactgatactgaaaagaaagccgacaagaaagatgaccctgccagcttcggggttgat
cgtcttgtctaa

DBGET integrated database retrieval system