KEGG   Lactobacillus casei 12A: LCA12A_0115Help
Entry
LCA12A_0115       CDS       T03665                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase / acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lcx  Lactobacillus casei 12A
Pathway
lcx00071  Fatty acid degradation
lcx00072  Synthesis and degradation of ketone bodies
lcx00280  Valine, leucine and isoleucine degradation
lcx00310  Lysine degradation
lcx00362  Benzoate degradation
lcx00380  Tryptophan metabolism
lcx00620  Pyruvate metabolism
lcx00630  Glyoxylate and dicarboxylate metabolism
lcx00640  Propanoate metabolism
lcx00650  Butanoate metabolism
lcx00900  Terpenoid backbone biosynthesis
lcx01100  Metabolic pathways
lcx01110  Biosynthesis of secondary metabolites
lcx01120  Microbial metabolism in diverse environments
lcx01130  Biosynthesis of antibiotics
lcx01200  Carbon metabolism
lcx01212  Fatty acid metabolism
lcx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lcx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LCA12A_0115
   00630 Glyoxylate and dicarboxylate metabolism
    LCA12A_0115
   00640 Propanoate metabolism
    LCA12A_0115
   00650 Butanoate metabolism
    LCA12A_0115
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LCA12A_0115
   00072 Synthesis and degradation of ketone bodies
    LCA12A_0115
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LCA12A_0115
   00310 Lysine degradation
    LCA12A_0115
   00380 Tryptophan metabolism
    LCA12A_0115
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LCA12A_0115
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LCA12A_0115
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LCA12A_0115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcx04147]
    LCA12A_0115
Enzymes [BR:lcx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LCA12A_0115
Exosome [BR:lcx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LCA12A_0115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: EKP98829
Position
complement(1790813..1791994)
Genome map
AA seq 393 aa AA seqDB search
MEEVVILSAKRTPIGKLGGDLAGASAVDLGVAAAQAAIKAARIDPALLNQAIFGNVMQAG
SGQNVARQIGLKSGMATSSTAMTVNEVCGSGLKAVRLGQAAIQLGEADAVLVGGTESMSQ
VPYYAEAVRSGHKFGDTTLVDGLSRDGLNDAFSQQPMGITAENVATQFNVSRQEQDEFAL
RSHLRAAAAAAEGRFKSQIAPVTIAARHGDVIVDRDSAIRPDTSLAKLAQLPPVFEVGGT
VTAGNASGINDGAAALILMAKSKAEQLGLHYLATVTGFAEVGIDPAIMGYAPKLAIDKIL
QATGGSIAAIDQIELNEAFASQSVAVARDLGLKDEQFNINGGALALGHPLGASGARILIS
LLYDLAERNQRQGIAALCVGGGIGIAMQIAMHV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagttgtgattctaagtgccaaacggacgccgattggtaagttgggtggtgat
ttggctggcgccagtgccgttgatttaggggttgcggcagcgcaggcggcaattaaggct
gcacgaattgacccagcgttactcaatcaggcgatctttggtaatgtcatgcaggctggt
tctgggcagaatgttgcccgacaaatcggattaaaaagcggtatggccactagcagcacg
gcgatgactgtcaatgaagtctgcggctcaggcctgaaggcagtgcggcttgggcaagct
gccattcaactcggcgaggctgacgcggtgcttgtgggcggtaccgaaagcatgagtcaa
gtaccttattacgccgaagcggttcgttcaggccacaaatttggtgatacaacgctggtc
gacggtttgagtcgcgatggattaaatgatgccttcagtcagcagccaatgggaatcacg
gcggaaaatgtggcgacacaatttaacgttagtcgtcaggagcaagatgagtttgctctt
cgttcgcatttacgcgccgcggccgccgcagctgagggtcggtttaagagtcagatcgcc
ccagtgacgattgctgcccgtcacggggatgtcatcgtagatcgtgattcagccattcgg
cccgatacgtcattggctaaattagcccaattaccgcctgtttttgaagtcggcggtact
gttacagcaggtaacgcaagcggcattaatgatggcgcagccgccttgatcctgatggca
aaatcgaaagccgaacaactggggctccattatttagcgacggtcactggttttgccgag
gtgggtattgatccggcaattatggggtatgcgccaaaactggcgatcgataaaatactg
caggcaaccggcggctctatcgcggcaattgatcaaattgaattgaatgaagcatttgcc
tcacaaagcgttgctgtggctcgtgaccttggtttaaaggatgaacaattcaatatcaat
ggtggcgccttagcgttgggtcatccattgggagcttcaggtgcccgaattttaatctca
ttattgtacgatctggctgaacgtaatcaacgccaaggcattgccgcattgtgcgttggc
ggtggcatcggtatcgccatgcaaatcgcgatgcatgtctga

DBGET integrated database retrieval system