KEGG   Lactobacillus casei 12A: LCA12A_0273Help
Entry
LCA12A_0273       CDS       T03665                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lcx  Lactobacillus casei 12A
Pathway
lcx00450  Selenocompound metabolism
lcx00970  Aminoacyl-tRNA biosynthesis
lcx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LCA12A_0273
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LCA12A_0273
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lcx01007]
    LCA12A_0273
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lcx03016]
    LCA12A_0273
Enzymes [BR:lcx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LCA12A_0273
Amino acid related enzymes [BR:lcx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LCA12A_0273
Transfer RNA biogenesis [BR:lcx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LCA12A_0273
 Prokaryotic type
   Other AARSs
    LCA12A_0273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: EKP96139
Position
complement(2548100..2550082)
Genome map
AA seq 660 aa AA seqDB search
MASKPTFYVTTPIYYPSGKLHIGNAYTTIAADVLARYKRLMGYDVFFLTGTDEHGLKIEQ
KADKLGVTPQAYVDGMATQIKQLWKMLEITNDKFIRTTDKEHIEAVQTIVERLIKQGDVY
LGEYTGWYSVEDEEYFTESQLSEVYRDKDGNVTGGKAPSGHEVQLVHEPSYFFKMSKYTD
RLLKYYDEHPDFVQPASRKTEMINNFIKPGLEDLAMSRTSFNWGVQIPSDPKHVVYVWVD
ALLNYITALGYGSNDHALFDKYWPANVQLIGKEIVRFHIIYWPIILMALGLPLPKKIYAH
GWLVMKDGKMSKSKGNAIYPDMIVERYGLDALRYYLMRAIPFGNDGIFTPEDFIDRINYD
LANDLGNLLNRTIAMINKYEDGILPAFKPDVTPFDQDLGDVAQAALAQYHKLMDELRFSD
ALDQVWKIVSRANKYIDETEPWNLAKDPAKKDQLDAVMAHLAESLRLIALLIQPVMTHAP
LQIFGQLGLDHENDDHKLVQWGALPAGAKVVEQGTPIFPRLDTEEEVAYIKSKMTPGTTK
ATVDEKTRKSEIEFKQFDKSEIRVAEILNVEPVKGADKLLKFTLDAGDEGTRQILSGIRE
FYPEYEKLKGKKVMAVVNLKPRKLKGEMSEGMLLSAESLDGKKITLLEVSENLENGSLVG
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcaaaccaactttttacgtaacaacaccaatttattacccatctggcaaacta
catatcggcaacgcctacaccacgattgcagcagacgtgctcgcacggtataagcggctc
atgggctacgacgttttcttcctaactgggaccgacgaacatggcctgaaaatcgagcaa
aaggctgataagttaggggtgacgccacaagcttatgttgatggcatggcgacccaaatc
aagcaactttggaaaatgcttgaaatcactaatgacaagtttatccggaccactgacaag
gaacatatcgaagccgttcaaacgattgtggaacgtctcatcaaacaaggggacgtctat
ttaggcgaatacactggctggtactccgttgaagacgaggaatacttcacggaatctcaa
ctgtcagaagtttatcgcgataaagacggcaacgtgaccggcgggaaagcgccgtctggt
catgaagtgcagctggttcacgaaccaagttacttctttaagatgagcaagtacaccgat
cgcttgttgaagtattatgacgagcatccggattttgttcaaccggcttcacgcaaaact
gaaatgatcaataactttatcaaaccgggtctggaagatctggcgatgagccggacgagc
ttcaattggggtgtccagattccatccgatccgaagcacgttgtttacgtgtgggttgat
gcgttgctgaactatattaccgccctaggctatggcagtaatgatcacgctttgtttgac
aaatactggccagccaacgtccaattgattggtaaggagattgttcgtttccacattatc
tattggccaattattttaatggcactcggcttgccgttgccaaagaaaatttatgcccat
ggctggctagtcatgaaagatggcaaaatgagtaagtcgaaaggcaatgccatttatccg
gacatgattgttgaacggtatggcttggatgccttgcggtattacttgatgcgcgccatt
ccgtttggtaatgatggtattttcacaccagaagactttattgaccgaatcaattacgac
ttggccaatgacctcggcaatctgttgaatcggaccattgccatgattaacaagtatgaa
gacggtattttgccagcctttaagccggatgtaacgccgtttgatcaagatcttggcgat
gtggcgcaggcggctttggcgcaatatcacaaattgatggacgagttgcgtttctccgat
gctttggatcaagtctggaaaattgtttcccgggcgaacaagtatatcgacgaaacggaa
ccgtggaatctggccaaagatcctgccaaaaaagatcagcttgatgctgtgatggctcac
ttggccgaaagtctgcgtctgattgctctactgattcaaccagtgatgacccatgcacca
ttgcaaatcttcggccaacttggcttggatcatgaaaatgacgaccacaagcttgtccaa
tggggcgctttgccagctggtgctaaagtggttgaacaaggcacaccaatcttcccacgt
cttgatacggaagaagaagtcgcttatatcaagagcaagatgacccctggcaccacgaaa
gccactgtcgacgaaaaaacgaggaagtcagaaatcgagttcaaacaattcgataagagc
gaaattcgggtcgcagaaattttgaatgtcgaaccggttaaaggcgctgataagttgttg
aagttcacgctcgatgcaggcgatgaaggcacacggcaaattctttccggtattcgtgaa
ttttacccagaatatgagaagctgaaaggcaaaaaggttatggccgtggtcaacttgaag
ccgcgcaagctaaaaggcgaaatgtctgaaggcatgttgttgtcggctgaaagtttagac
ggcaagaaaatcactttgctggaagtctctgagaacttagagaatggcagcttggttggt
taa

DBGET integrated database retrieval system