KEGG   Lactobacillus casei 12A: LCA12A_2398Help
Entry
LCA12A_2398       CDS       T03665                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
lcx  Lactobacillus casei 12A
Pathway
lcx00051  Fructose and mannose metabolism
lcx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LCA12A_2398
Enzymes [BR:lcx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     LCA12A_2398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh NAD_Gly3P_dh_N F420_oxidored
Motif
Other DBs
NCBI-ProteinID: EKQ01445
Position
429375..430559
Genome map
AA seq 394 aa AA seqDB search
MATAVHFGAGKIGLGFIGDLLHQSGYHIVFADVVEKTVAQLRKEKQYRLFLIDHDYQERI
IDNVDAVSSIQDPDGVVEAMTHADIVTTSVMASNLPKVAPLIAKGLKARLEKHLPKMTVM
ACENAIMGTDILKKAMLDTGEMTSEQLEQAAVYPNTAVDRVVFDGHHHGQEGIEVGDAYE
LAIERGKLLDPNSEPIKGAEYVDNLEMYLQRKIYIINCGHAISAYLGQVHGYHTVQEVLH
NERLLHQVKAAMAESAAALEAKYHFSKQSLQDYIETMFVKRMTTPGLSDPVTRVGREPIR
KLSPNDRIIGPANECESFGLDNQYLLRGAACALLFHNPDDKQAVKMQQFIQTHGIEKAIA
QYTKIQPNSAMFEKLLKAYWEAKAKLPANVGNAK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgcagtccattttggcgcaggaaaaatagggttagggttcattggagatttg
cttcatcaaagcggctatcacattgtctttgcagatgttgttgagaagacagtggcacag
ttgaggaaagagaaacagtatcgactttttctaattgatcacgattatcaagaacggata
atcgacaatgtggatgctgtttcttccattcaagatcctgatggtgtcgttgaggcaatg
acacatgccgacatagtgaccacatcagtcatggccagtaacttacccaaagttgcgcca
cttatcgcgaaaggcttgaaggcgcggttagaaaaacatctgcctaaaatgacggttatg
gcttgtgagaatgccattatgggaacagatatcctaaaaaaggcaatgctcgatacaggc
gagatgaccagtgagcagcttgaacaagcggcagtttatccaaatacggctgttgatcgc
gttgtatttgatggtcatcatcatgggcaagagggtattgaagtgggcgacgcgtatgaa
cttgcgatcgaaagaggaaagcttttagatcctaatagcgaaccaattaaaggcgcagaa
tacgttgataatttggaaatgtacctgcaacgtaagatttatatcattaactgtggtcat
gcgatcagtgcttatctgggtcaagttcacggctatcacacggttcaagaagtcttacac
aacgagagactattgcaccaagtgaaggcggctatggcagaatcggcagcagcccttgag
gcgaagtatcatttttcgaaacagtcactgcaagattatattgagacgatgttcgttaag
cggatgacgacacctggcttatctgatccggtgacgcgtgttggccgagaaccgatccgc
aagctttctcccaatgaccggatcattggccctgcgaatgaatgcgagtcttttggctta
gataatcaatatttattacgcggtgctgcgtgtgccttgcttttccataatcctgatgat
aagcaagcggtcaaaatgcagcagtttatccaaacgcatggaattgaaaaggccattgct
caatatacgaagattcaaccgaatagtgcaatgtttgagaagttgctgaaggcgtattgg
gaagcgaaggcgaagttgcctgccaatgttggcaatgccaaatag

DBGET integrated database retrieval system