KEGG   Lactobacillus casei 12A: LCA12A_2554Help
Entry
LCA12A_2554       CDS       T03665                                 

Definition
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
lcx  Lactobacillus casei 12A
Pathway
lcx00730  Thiamine metabolism
lcx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LCA12A_2554
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lcx03000]
    LCA12A_2554
Enzymes [BR:lcx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     LCA12A_2554
Transcription factors [BR:lcx03000]
 Prokaryotic Type
  Other transcription factors
   Others
    LCA12A_2554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 Haem_oxygenas_2
Motif
Other DBs
NCBI-ProteinID: EKQ01844
Position
340688..341380
Genome map
AA seq 230 aa AA seqDB search
MKFSEKARQQVVPYWEGSFTHPFITELQAGNLDPAIFRFYLIQDAYYLQHFTHLYTLIAA
QTQEPELKAYALQSAEGLAQGEITIRHVFFAELNISTTELAATTIAPTTYHYVSHMYRQL
VEGTPHVAIAGMLPCPWLYQEVAQQLQQRKSPVPIYQRWIDTYSGADNADDQRAAIALID
RLYDQSMPTEQQQMLAAFRISSQMEYSFWEMAYHLEAWPKGAKVDDTKQR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttctgaaaaagctcggcagcaagttgttccgtactgggaaggcagcttcact
cacccatttattacggagctacaagctggcaaccttgatccggcgattttccgcttttat
ctgattcaggatgcttattatctgcaacattttacacatttatatacgctgattgccgca
cagacgcaggagccggaattgaaagcttatgcgctgcagtcggctgaaggtttggcccaa
ggtgaaattacgatacgccacgtttttttcgccgaattgaacatctcaacaactgagctg
gcggccaccacgattgcgccgaccacgtatcactatgtttcccatatgtaccgacaattg
gttgaaggcacgccgcatgtggcgattgcggggatgctgccatgtccatggttgtatcag
gaggtggcacagcagttgcagcaacgaaaatcacccgtgccgatttatcagcgctggatt
gacacttatagcggtgcggacaacgcggacgatcagcgagcggcgattgcgttgattgat
cggttgtacgaccaaagcatgccgactgagcagcaacaaatgctggctgcgtttcggatc
agcagtcaaatggaatacagcttttgggagatggcgtatcacttagaagcgtggccgaaa
ggagcaaaggttgatgacacaaagcagcgttaa

DBGET integrated database retrieval system