KEGG   Lactobacillus coryniformis: LC20004_04405
Entry
LC20004_04405     CDS       T05341                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
lcy  Lactobacillus coryniformis
Pathway
lcy00230  Purine metabolism
lcy01100  Metabolic pathways
lcy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lcy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LC20004_04405
Enzymes [BR:lcy01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     LC20004_04405
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ATO43188
UniProt: A0A2D1KM47
Position
916098..918401
AA seq 767 aa
MGNKTVVGHSEQRWDAIAKVKGQAKFTADFPFKNMLYEKILRSTIAHGYVESYDTSEALK
VPGVVKIFLPEDLPQNKYSTAGHPWTLVQEKRDIQDRTILTRHVRVYGDDIAAVVAKSEL
AAIQALAKIKVTYKKYPVYWTPKEAMAVGAQRIHEERDNVIADTCVGFGDVTKSMAEADY
VIKEQLSTSVQQHVHMENQIAVAYQDADQRWTCVSSTQIPHICRRIIAQAVGVSWSKIRV
KKPFIGGGFGNKQDAVVEPLVVALSMACNGQPIQLALTREESIGNTRTRHAIDYNFSIGV
KKDGTITAIDCEVFSNQGGYASHGHAIGGKGGTFINAIYKMDSLRYAAKTVYTNIATAGA
MRAYGMPQVVFALESVIDDAAEKIGMDPIEFRYKNRRPNGFYNEMSHVKQINFKVGECLE
KGRKEFAWDKKLAASQAYKTGTKRLGVGIAAFSFGTAVYPFGLEVSGARLILMPDGCFKL
MLGSTEIGQGADTAMSQMAAETIGVPFKNIIRDSFTDTDIDPYDTGAYASRQSYVTGFAV
KEAAEKMKTKILARAAQTYDVRAEYIDIINGEIIYIPNGERLATLEEVAMASYFDMKDGK
TITADSAVNIHQTTYASGCTLAEVEVDIETGRVKLLSIMNVHDSGKIINPLLATGQVEGG
MAMGIGYGLSEGLRYDKTGRPLNNNLLDYKLPTTMDLPELKHTFVETDDPLGPFGNKSLG
ENPTVSPAPAIRNAVKNAIGIGINNLPLSPENVYEHLQVLKEGGQHV
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgggaaataaaacagttgtggggcattcagaacagcgctgggatgcaattgctaaagtg
aaaggtcaagctaaatttacagcagattttccgtttaagaatatgctctacgagaaaatt
ttacgttcgacgattgcccatgggtatgttgaaagttatgacacttctgaagcgttgaag
gtgccgggagtggttaaaattttcttacctgaagatctgccacaaaataagtactccacg
gcgggacacccatggacactagttcaagaaaaaagggatattcaggatcgaacgatcttg
acccgtcatgttcgtgtatacggtgacgatattgcggctgtagtggctaaatctgaatta
gctgcgatacaggcattagccaagatcaaagtcacatataaaaaatatccggtttattgg
acgcccaaagaagcgatggctgtgggagcgcaacgtattcatgaagaacgggataacgtt
atcgcggatacttgtgtgggttttggggatgttactaaaagtatggctgaagctgattac
gtgattaaggaacagttgtcgacttcggtacaacagcatgtccatatggaaaatcaaatt
gcagttgcttatcaagatgcagatcaacgttggacttgcgtgagttcaacccagattcca
catatctgtcgacgaatcattgcgcaggcagtcggggtttcttggtcaaaaattcgagtt
aagaaaccatttattggtggtgggtttggcaataagcaggatgcagtggtcgaaccgttg
gtagtcgcactaagcatggcttgtaatggccaaccgatccaattagctttgacgcgggaa
gaatcaattggtaatacgcggacgcgccacgcaattgactacaatttctcgattggtgtt
aaaaaagatggtacgataacagcaattgattgtgaagtcttctctaatcagggtggctac
gcttcacacgggcatgccatcggtggtaaaggtggaacttttattaacgcaatctataaa
atggatagtttgcgttatgctgctaaaactgtgtacaccaatattgcgacggctggtgca
atgcgggcctacggaatgccgcaagtagtctttgcgttggagtcggtgattgatgatgct
gctgaaaagattggcatggatccgattgagtttcggtacaagaatcggcgtcctaatggc
ttttacaatgaaatgagccacgttaagcaaattaactttaaggttggagaatgcctagaa
aaagggcgtaaagaattcgcctgggataaaaaattagctgccagccaggcatataaaaca
gggactaaacggcttggggtagggattgctgccttttcgtttggcactgcagtttatccg
tttgggcttgaagtttccggtgcacgcttgattttaatgccggatggttgctttaaattg
atgttaggatccactgagatcgggcagggtgccgatacggcaatgagtcagatggctgct
gagacgattggggttccctttaagaatattattcgcgattctttcacggatactgatatt
gatccttatgatactggtgcttatgcatcacggcaaagttatgtaactggttttgccgta
aaggaagcggccgagaagatgaagacgaagattttagcgcgtgctgcccaaacttatgat
gttcgtgccgaatatatcgatataattaacggtgaaatcatctatattcctaatggagag
cggttagctaccttagaagaggtggcgatggcttcatattttgatatgaaagatggtaaa
acgattactgctgattcagcggtcaatattcatcaaaccacctatgcttctggctgtact
ttagcagaagtagaagttgatattgaaacgggccgagtaaaactgttgagcattatgaat
gttcatgactctggtaaaattattaatccactattggccactggtcaagttgaaggtggg
atggcaatgggcattggctatggtttgagcgaaggcttgcgctatgataaaacgggtcgg
ccattaaataataatttgttggattacaagttgccgaccacgatggacttacctgaactc
aaacacacctttgttgagaccgatgatccattagggccgtttggcaataaatcattaggt
gagaatccgactgtttcaccagcaccggcgattcgtaatgcagttaagaatgcgatcggt
atcggcattaacaatttaccattgtcaccagaaaatgtttatgaacatttacaagtgttg
aaagaaggtggtcaacatgtttga

DBGET integrated database retrieval system