KEGG   Lactobacillus coryniformis: LC20004_09990Help
Entry
LC20004_09990     CDS       T05341                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
lcy  Lactobacillus coryniformis
Pathway
lcy00471  D-Glutamine and D-glutamate metabolism
lcy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LC20004_09990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lcy01011]
    LC20004_09990
Enzymes [BR:lcy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     LC20004_09990
Peptidoglycan biosynthesis and degradation proteins [BR:lcy01011]
 Precursor biosynthesis
  Racemase
   LC20004_09990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Flavodoxin_3
Motif
Other DBs
NCBI-ProteinID: ATO44208
UniProt: A0A2D1KPY5
Position
complement(2024507..2025352)
Genome map
AA seq 281 aa AA seqDB search
MVNVQQGIGYMDSGVGGLTVVKEALRQLPNEQVIFIGDTARNPYGPRPASQVKEFTWQMT
NFLLSKHVKMIVIACNTATAAALPEIQTALDIPVIGVIVAGSQAAIKATKNKKVGVIGTI
GTIKSQAYPQAIARQAPQVEVTGVACPKFVPLVESDEYKSAVAKKVVAESLTPFDNQHID
TLILGCTHYPLIRHLIQNRIGDQVTLIDSGAETVNQLSALLEFDQLAAPARQPQHEFYTT
GNPEMFQRIAGDWLELNDLDVRHIDLTELIKHSEVKHAKKS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatgtacaacaaggcattggctatatggattcgggcgtgggtggcctgacggtc
gtgaaagaagcgttacgccagctaccgaatgaacaggttatttttattggcgatacggca
cgtaatccttatggaccacggccagctagtcaagttaaagaatttacgtggcagatgact
aatttcttgttaagtaagcacgttaagatgattgttattgcctgcaatacggctactgct
gcggctttaccagaaatccagacagctttagatattcctgtgatcggtgtgatcgtggcg
gggagtcaggcagcaatcaaggcaaccaaaaataaaaaggttggtgtgatcggaacgatt
ggaaccatcaagagtcaggcctatccgcaagcgattgcgcggcaagcaccacaagttgaa
gtaacgggtgtcgcgtgtcctaagtttgtcccgttagttgaaagtgacgaatataaatcg
gcggttgctaaaaaagtagtcgccgaatcgctgacgccatttgataatcagcatattgat
actttgattttgggctgcacgcactatcccttgattcgtcatttgatccaaaatcgaatt
ggtgatcaagttactttgatcgattctggtgccgaaacggtcaatcaactttctgcgtta
ttggaatttgatcaattagcagcaccggcacgacaaccacaacatgaattttataccacc
ggtaatccggaaatgttccagcgaatcgcgggggactggttagaattaaatgatttagat
gttcgccatattgatttaacggaattaattaaacatagcgaggttaagcatgcaaagaaa
tcataa

DBGET integrated database retrieval system