KEGG   Lactobacillus coryniformis: LC20004_10075Help
Entry
LC20004_10075     CDS       T05341                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
lcy  Lactobacillus coryniformis
Pathway
lcy00030  Pentose phosphate pathway
lcy00480  Glutathione metabolism
lcy01100  Metabolic pathways
lcy01110  Biosynthesis of secondary metabolites
lcy01120  Microbial metabolism in diverse environments
lcy01130  Biosynthesis of antibiotics
lcy01200  Carbon metabolism
Module
lcy_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lcy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LC20004_10075
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LC20004_10075
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcy04147]
    LC20004_10075
Enzymes [BR:lcy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     LC20004_10075
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     LC20004_10075
Exosome [BR:lcy04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   LC20004_10075
  Exosomal proteins of colorectal cancer cells
   LC20004_10075
  Exosomal proteins of bladder cancer cells
   LC20004_10075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ATO44224
UniProt: A0A2D1KQ04
Position
complement(2042520..2044022)
Genome map
AA seq 500 aa AA seqDB search
MQNEKVALFIIFGGSGDLARRKLYPSLFRLYQKGYLDQHFAVIGTARRPWTDDYYHQIVT
ESLSDLQATDEQVAAFASHFYYQSHDVTNAEHYVVLEELAKKLDQKYELQDNRIYYMAMS
PNFFGTIAKHLKSEQILTEDGFNRLIIEKPFGHDYQSAKELNEQIRASFAEDQIYRIDHY
LGKEMVQNISAIRFGNNIIESLWNNRYIDNIQITLSEALGVEERAGYYETAGAMRDMVQN
HISQIATLLAMEPPVSFSATDIRHEKIKVLRSLHIDTPEEARRNFVRGQYGPATIDGTRL
EGYREAEQVASDSKTETYVAGKMEFENYRWAGVPFYVRTGKRLAKKATRVDIVFKQLPMN
IFKTVSDDDKLGDNVLTIYVEPTEGFGLRVNAKRLGQGFETRPVDLDFRHSAAAAGNSPE
AYERLLLDALNGDSTNFTHWDELSQTWKFADVIEQVWAETTPTDFPNYASGSMGPEAATE
LLARDGRHWIYDPTQALPKE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacgaaaaagtagctttatttattatttttggcggttctggtgatttagcgcgg
cgcaaattatacccatcgctatttcgactttatcagaagggctatttagatcaacatttt
gcggtgattggcactgcacggcgaccatggactgatgattattatcatcagatcgtgacg
gagtctttaagtgatctgcaagcaactgacgaacaggtcgctgcttttgctagtcacttt
tactatcaatctcatgacgtgactaatgcggaacattatgtggtcttggaagagctagct
aaaaagcttgatcaaaagtatgaattacaagataatcgaatctattacatggcaatgtcg
cctaactttttcggcacaattgcaaaacatctaaagtcagaacaaattttaactgaagat
ggttttaaccgcctgatcattgaaaaaccatttggtcatgattatcaaagtgcgaaagaa
ttaaatgaacagatccgggcgtcttttgctgaagatcagatttaccgaattgatcattac
ttaggtaaggaaatggtgcagaatatttcagcaattcgtttcggtaataatattattgaa
tccctatggaataatcgttatatcgacaatattcagatcacattaagtgaagctttaggc
gttgaggagcgggctggatattacgaaactgcaggtgcaatgcgcgatatggtccaaaat
catatttcacagattgccactttgttggcgatggaaccaccagtttcgttttcagccacg
gatattcgccatgaaaaaatcaaagttttgcgcagtttgcatattgatacgccggaagaa
gcacgtcgtaacttcgttcgcggtcagtatggtccggcgacgattgatggtacgcgttta
gaaggttatcgtgaagccgaacaagtggcttctgattcgaaaactgagacctatgttgca
ggcaaaatggaattcgaaaactatcgttgggctggtgtgccattctatgtgcggacgggg
aaacgtttggctaaaaaagcgacccgggttgacattgtcttcaaacaattaccgatgaat
attttcaaaacggtcagtgatgatgataagctaggcgataatgtattaaccatttatgtt
gaacccactgaaggtttcgggttacgagttaatgctaagcgcttaggccaaggctttgaa
acgcgaccagttgatcttgatttccggcatagtgccgcagctgccggtaacagtccggaa
gcttacgaacgtttactactagatgcgctcaatggtgactcgaccaactttacccattgg
gatgaactttcacagacgtggaaattcgctgatgtgattgaacaagtttgggcagaaaca
accccaactgatttccctaattatgctagtggttccatgggtccggaagcggcgactgag
ttattagcgcgtgacggacggcattggatctatgatccgacacaggcattaccaaaagaa
taa

DBGET integrated database retrieval system