KEGG   Lactobacillus paracasei Zhang: LCAZH_0188Help
Entry
LCAZH_0188        CDS       T01280                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
lcz  Lactobacillus paracasei Zhang
Pathway
lcz00430  Taurine and hypotaurine metabolism
lcz00620  Pyruvate metabolism
lcz00640  Propanoate metabolism
lcz00680  Methane metabolism
lcz01100  Metabolic pathways
lcz01120  Microbial metabolism in diverse environments
lcz01200  Carbon metabolism
Module
lcz_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:lcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LCAZH_0188
   00640 Propanoate metabolism
    LCAZH_0188
  09102 Energy metabolism
   00680 Methane metabolism
    LCAZH_0188
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    LCAZH_0188
Enzymes [BR:lcz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     LCAZH_0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ADK17484
UniProt: K6S5U6
Position
181463..182653
Genome map
AA seq 396 aa AA seqDB search
MAKILAVNAGSSTLKWKLFDMPAEVQLAEGLVDRLGQPQSKVKIKYGDGQKYESDTPIAN
YQEAVASLMGNIKALGLVEHLHEITGVGHRVVAGGETFAESVVVDDATLLQIQNLRDYAP
LHNPVEADYIDVFKKMMPWATEVAVFDTAFHQTMQPENFLYSIPYDYYKKYGARKYGAHG
TSVRYVSARAAEMLNKPLEDLRMIVMHLGSGSSVTAVQGGQSIDTSMGFTPLAGVTMGTR
SGDIDPSLVAYLMKKLDVPDVGQMIHILNNDSGLLGISGISNDMRDLEADEDTKPRAKLA
LDIFVNRVVKYVGSYAALMDGVDVLVFTAGIGENGDEIRDKIMRSLDYLGAKIDNDINYK
SHGVEADLSTPDSTVKTLLVPTNEELMIVRDVMALS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaattctcgcagtcaacgcaggcagttcaaccctgaagtggaagctttttgat
atgccagctgaggttcagctggcagaaggtttggttgatcggttgggacagccgcaatca
aaagttaaaattaagtatggtgatgggcagaaatatgaaagcgatacgccaattgctaac
tatcaagaagccgtcgccagtttgatgggtaacatcaaggcgttagggttggttgaacat
ctgcatgagattactggtgtgggccatcgtgtggtagccggcggggagacttttgccgaa
tccgttgtagttgatgatgctaccttgttgcagattcaaaacctgcgtgactatgcgcct
ttgcataatccggttgaagcagattacattgatgttttcaaaaagatgatgccatgggcc
acagaagtcgcagtgtttgatacggcgttccatcaaaccatgcaacctgagaacttcctc
tacagtattccctatgactattacaagaaatatggtgctcgcaaatatggcgcccacggg
acaagtgtgcgttacgtcagcgcgcgggcagctgagatgcttaacaagccgttagaagac
ttacggatgattgtgatgcatttaggctcaggctccagtgttaccgcagtccaaggcggg
cagtctattgatacttccatgggctttacgccgttagccggggtgacgatggggacacga
tccggggatattgacccatcacttgtggcttatctcatgaagaaacttgatgtccctgat
gtggggcaaatgattcatatcctgaacaacgattccggcctgctcggtatttccggcatc
agcaacgacatgcgggatctggaagctgacgaagataccaagccacgcgccaaactggca
ttggatattttcgttaaccgcgttgtgaagtacgtgggttcgtacgcagccttgatggac
ggcgtggatgtgcttgtcttcacagccgggatcggcgaaaacggtgacgagattcgcgac
aagatcatgcgttcactcgattacctcggcgctaagatcgacaatgacatcaactacaag
tcacacggcgtcgaagccgacctcagcacaccagattcaactgtgaaaacattgctcgta
ccaaccaatgaagaactgatgatcgtccgtgacgtcatggcgttgagctaa

DBGET integrated database retrieval system