KEGG   Lactobacillus casei Zhang: LCAZH_0391Help
Entry
LCAZH_0391        CDS       T01280                                 

Definition
(GenBank) sucrose phosphorylase-like protein
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
lcz  Lactobacillus casei Zhang
Brite
Enzymes [BR:lcz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     LCAZH_0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Glyco_hydro_42C
Motif
Other DBs
NCBI-ProteinID: ADK17683
Position
384794..386212
Genome map
AA seq 472 aa AA seqDB search
MFPYTSDDGFSVTDYMAINPDLGDWQDVYALRQSKRLMFDFVANHMSANSLWFKRFMNHD
AGFEKAYIEFDPTFDTSKVIRPRVSPLFHTYQNDRGETKTVWTTFSEDQVDINFGDPLML
ARQTKVLLEYAKRGAASIRLDAIGFIWKESGTTCMHRPETHEIVRLWRTLLDHFAPNTQI
ITETNVPNKENISYFGQGDDEAHQVYQFPLPPLVLYSFISGDADHLQEWAKTVQAPSSKA
TFFNFLASHDGIGLRPVEGILSADERQRIIDRVLTNHGQVSYKDNPDGTKSVYELNINYG
DALRISTDTDAEAANKMIAAHNILVSMVGVPAIYYHSMFGSKGDLKAVKETGMNRRINRE
RVDYDRLKNELRTDQYRQKVYAGISHLLKVRQKNIAFNPFGKQEVLELGKQIFAVKRFSD
DGSAIISFTNVSSQPATIHNIEGRELLSEKLVRNDLRLKPYGIAWLKMEASK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgttcccatatacatcagatgatgggttttccgtcacagattacatggccattaatccg
gatcttggtgattggcaggacgtctatgcgctgcgacagtcaaagcggctgatgttcgat
tttgttgctaatcacatgtctgcaaacagtctttggtttaagcgttttatgaaccatgat
gctggttttgaaaaggcgtatatcgaatttgatccaacttttgatacatcaaaggtgatt
cggccgagagtttcgccactttttcatacttatcaaaatgatcgtggtgaaactaagacg
gtttggacaaccttcagtgaagatcaagttgatattaattttggcgatccactcatgtta
gctcgtcagacaaaggtgttgcttgaatatgcaaagcggggcgcggcctcgattcgcttg
gacgccattggttttatttggaaagaaagcggcactacttgcatgcatcgcccggagacc
catgaaattgtccgactgtggcgaacactgcttgaccattttgcgccgaatactcagatc
attactgaaacaaatgtgccaaataaggaaaacatcagctattttggccagggtgatgac
gaagcgcaccaagtctatcaatttccgctaccgccattggttctttatagttttatttcc
ggggatgctgatcatcttcaagagtgggctaaaactgtgcaggcaccatctagtaaagcc
actttcttcaactttcttgcttcacatgatggtattgggttgcgaccagttgaaggcatt
ttaagtgcggacgaaaggcaacgcatcattgaccgggttttaaccaaccatgggcaagtg
tcgtacaaagataacccagacggcaccaagtctgtttatgagttgaatataaactatggc
gatgctttaagaataagcactgatacggatgcagaagcggccaataagatgatcgcggca
cacaatatcctagtctcaatggtcggcgtaccagcgatctactaccactcaatgtttggc
tctaaaggtgaccttaaggcggttaaagaaactggtatgaatcgccgcattaatcgcgaa
agagttgactatgatcggttgaagaatgagctacggacagatcagtatcgtcaaaaagtt
tacgcaggaatcagtcatttactcaaagttcgtcaaaagaacatcgcctttaatccgttt
ggcaaacaagaagtattagaacttggaaagcagatttttgccgtgaagcggtttagtgat
gatggctcagcgattatttcatttacaaatgtttcaagtcagccagcaactatccacaac
attgagggtcgagagctgctatcagagaagcttgtcaggaatgatttgcgactgaagcca
tacggtattgcgtggttgaagatggaggcatcaaagtga

DBGET integrated database retrieval system