KEGG   Lactobacillus paracasei Zhang: LCAZH_0739Help
Entry
LCAZH_0739        CDS       T01280                                 

Definition
(GenBank) D-alanyl carrier protein
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
lcz  Lactobacillus paracasei Zhang
Pathway
lcz00473  D-Alanine metabolism
lcz01100  Metabolic pathways
lcz01503  Cationic antimicrobial peptide (CAMP) resistance
lcz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lcz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LCAZH_0739
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LCAZH_0739
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LCAZH_0739
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:lcz01504]
    LCAZH_0739
Enzymes [BR:lcz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     LCAZH_0739
Antimicrobial resistance genes [BR:lcz01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    LCAZH_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: ADK18024
UniProt: A0A0K1KXA0
Position
744144..744389
Genome map
AA seq 81 aa AA seqDB search
MADEAIKNGVLDILADLTGSDDVKTNLDLNLFETGLLDSMGTVQLLLELQSQFGVEAPVS
EFDRSQWDTPNKIIAKVEQAQ
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgaagcaattaaaaatggtgttttagatattttggcagatttaaccggttct
gatgatgtgaagacaaatttggatctgaatctgtttgaaaccggcttgttagattcaatg
gggacggtacaactgttgttggaactgcaaagccagttcggcgtagaagcacctgtttct
gaatttgatcgtagtcaatgggatacccctaacaaaatcatcgcaaaggtcgaacaagca
caatga

DBGET integrated database retrieval system