KEGG   Lactobacillus casei Zhang: LCAZH_1301Help
Entry
LCAZH_1301        CDS       T01280                                 

Definition
(GenBank) acetoin/pyruvate dehydrogenase complex, E2 component, dihydrolipoamide succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lcz  Lactobacillus casei Zhang
Pathway
lcz00010  Glycolysis / Gluconeogenesis
lcz00020  Citrate cycle (TCA cycle)
lcz00620  Pyruvate metabolism
lcz01100  Metabolic pathways
lcz01110  Biosynthesis of secondary metabolites
lcz01120  Microbial metabolism in diverse environments
lcz01130  Biosynthesis of antibiotics
lcz01200  Carbon metabolism
Module
lcz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCAZH_1301
   00020 Citrate cycle (TCA cycle)
    LCAZH_1301
   00620 Pyruvate metabolism
    LCAZH_1301
Enzymes [BR:lcz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LCAZH_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF1780
Motif
Other DBs
NCBI-ProteinID: ADK18535
Position
1258935..1260596
Genome map
AA seq 553 aa AA seqDB search
MAFEFKLPELGEGLAEGEIVKWDVKPGDDIKEDDTLLEVQSDKSVEEIPSPVSGKILKIL
VPEGETASVGDLLVEIDDGSGPAAAPAAPATATAAPATPAPATSAQPAPAQSVYQFKLPE
LGEGLAEGEIVKWSVKPGDQIKEDDTLLEVQSDKSVEEIPSPVAGTVVKILVPEGETATV
GEALVDIDALGHNDTSVATEAGAAPQPVAATPAATPAAPAAGGVPAITDPNREILAMPSV
RQYAREQGIDISQVPATGKHGRITKADVDAFKTGAPAASAQPAAPAAQAQPQPATAKPAA
PAAPKPQAVAPYVSSGNEAELETREKMTPTRKAIAKAMLASKQRSPHVTSFDDVEVSKLM
AHRKKYKQYAADKGIKLTFLPYIVKALVTVLREYPEFNASIDDTTDEIVYKHYFNIGIAT
NTDHGLYVPVIKNADAKSMFEIAKEISENAQKAYDSKLKPDEMRGGSMTISNVGSIGGGW
FTPVINQPEVAILGVGKIAKEPYVNEDNEIVVGNMLKLSLSYDHRLIDGALAQTALNLMD
KLLADPDLLLMEG
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattcaaactgccagaacttggcgaaggtttggcagaaggcgaaatcgtt
aagtgggacgtcaaacctggtgatgacatcaaggaagacgataccttacttgaggttcaa
agtgataaaagtgttgaagagattccatccccggtctccggcaaaattttaaaaattctt
gttccagaaggggaaaccgcgtcagttggtgatctattggttgaaatcgatgatggctcc
ggaccggcagctgcaccggctgcacctgcgactgcaacagcagcccctgcgacacccgct
ccagcaacgtctgcgcaacctgcacctgcgcaatcggtttatcagtttaagttacccgaa
ttaggcgaaggtttggcagaaggcgaaattgttaaatggtcagtcaagcctggcgatcaa
atcaaagaagacgacacgctgttagaagttcaaagcgacaagagtgtcgaagaaattcct
tctccagttgccggaacggttgttaagattctggtaccagaaggcgaaaccgcgacagtc
ggtgaagcgctggttgatattgatgcactgggtcataatgacacatcggttgctactgag
gctggcgctgcaccgcagccggttgctgcaacaccggctgcgacgccagctgcaccagca
gcgggtggcgtgccggccatcaccgatccgaaccgggaaattttagcaatgccatctgtg
cgtcagtatgcacgcgaacagggcattgacatctcacaagtgccagcaaccggcaaacat
ggccggattaccaaggctgatgtcgatgcattcaagacgggcgcaccagctgcatctgca
cagccagcagcccctgctgctcaggcacaaccgcaaccagccacagcaaagccagctgca
ccggcagcaccaaagccgcaagcagttgcaccatacgtttcgagtggtaatgaagctgaa
cttgaaacccgtgaaaagatgaccccaactcggaaagcgattgctaaggcgatgcttgct
tctaagcaacgtagcccgcatgtgacgagttttgatgacgttgaagtttctaagttaatg
gctcatcgcaagaagtacaagcaatacgcagctgataaaggtatcaagttaaccttcctg
ccgtatatcgtcaaagcacttgtgacggtgttgcgtgaatatccggaattcaatgcgtcc
attgatgatacaacggatgaaattgtctataagcattacttcaacattgggattgcaacg
aatacggatcacggcttgtatgtgcctgtgatcaagaatgccgatgcaaagagtatgttt
gaaattgctaaggaaattagtgaaaatgcccagaaggcttatgacagcaaactaaagccg
gatgaaatgcgcggtggctccatgaccatcagtaacgttgggtcaattggcggcggctgg
ttcaccccagtgatcaatcaacctgaagttgcgattctcggagtgggcaaaattgctaag
gaaccttatgtcaacgaagacaacgaaattgtggttggcaacatgttgaaattaagtttg
agctatgaccatcgtttgattgacggcgcgttagcacaaaccgccttgaatctgatggat
aaattgttggcagatcctgatctgctgttgatggagggataa

DBGET integrated database retrieval system