KEGG   Lactobacillus paracasei Zhang: LCAZH_1496Help
Entry
LCAZH_1496        CDS       T01280                                 

Definition
(GenBank) glycyl-tRNA synthetase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
lcz  Lactobacillus paracasei Zhang
Pathway
lcz00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lcz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LCAZH_1496
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lcz01007]
    LCAZH_1496
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lcz03016]
    LCAZH_1496
Enzymes [BR:lcz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     LCAZH_1496
Amino acid related enzymes [BR:lcz01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   LCAZH_1496
Transfer RNA biogenesis [BR:lcz03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LCAZH_1496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1 sCache_3_2
Motif
Other DBs
NCBI-ProteinID: ADK18728
UniProt: S4ZMG8
Position
complement(1468694..1470763)
Genome map
AA seq 689 aa AA seqDB search
MTHQYLIEIGLEDMPAHVVTPSLQQFHDKTVAFLKENHLDHGVIDQYATPRRLALLIHDL
ADKQADVEEDVKGPAKKIAQDADGNWTKAAIGFSRGQGMTPDDIVFKTIKGVDYVYLHKA
IKGKTAAAILPGMLDVIKSLTFPTRMKWGAYDFEYIRPIHWLVSLLDDAIVPMKLLDVDA
GRTTQGHRFLGRPVTLGNAADYVAALKAQFVIVEPAARKQLISDQIHQIAADHQWQIDLD
ADLLEEVNNLVEWPTAFAGNFDEKYLKIPEAVLITSMKDNQRYFYARDASGKMVNAFIGV
RNGNADHLANVIAGNEKVLTARLEDAAFFYAEDQKRSIADDVDRLKAVSFHDKISSMYDK
MARTRVIADLLADRFGLSATDKADLDRAASIYKFDLVTSMVGEFPELQGIMGEHYAQLAG
EKPAVAQAIAEHYEPISADGALPESLVGTVLAIADKFDSLMSFFAVDLIPSGSNDPYALR
RQAYGIVRMIAKHDWPFAVAELQTTIADALKAAGKTNNLDFAAHQQDLNAFMIDRAKQVL
QAQKIRHDIVDAVTVRADADLAGILDAAKILSAHADDTDFKPVMEALGRVLRITKKQQVK
VDVDTAKFENPSEGQLYDATVATAKKFDDEPTEADYQALKALADPINAYFDATMVMADDQ
AIRQNRLAALLQLAALIKQFGDVSQVIVK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatcaatatctgattgaaatcgggcttgaggacatgccagcgcatgtggtgaca
ccgagtttgcaacagtttcacgataaaaccgtcgcttttttgaaagaaaatcatctcgat
cacggcgtgattgaccagtatgcaacaccgcggcgcttagcattgctgattcacgacctc
gctgacaagcaagcggacgtcgaagaagacgtcaaaggcccagctaagaaaattgcgcaa
gatgcagatggcaactggaccaaggcggcgatcggcttttctcgcggccaaggcatgacc
cctgatgacattgtctttaaaacgatcaaaggtgtggattacgtttatctgcataaggca
atcaagggcaaaacagcagcagctattttaccaggtatgctggatgtcattaaaagcctg
accttcccaacccgaatgaagtggggcgcttatgacttcgagtacattcggccgattcat
tggctggtcagcttgctggatgatgcgattgtcccgatgaagttgctggatgttgacgct
ggcagaaccactcaaggtcatcgcttccttggcagaccagtgactctcggcaatgcggcc
gactatgttgcggccttaaaagcacaatttgtgattgttgaaccggcagcgcgcaagcag
ttgattagcgatcagattcaccaaattgccgctgatcatcaatggcagattgatcttgat
gcagacttgctggaagaggtcaataatcttgttgaatggccaactgcatttgctggtaat
tttgatgaaaagtatctcaaaattcctgaagctgtgctgatcacctcaatgaaagataat
caacgttacttctatgcgcgggatgcgtcaggaaagatggtcaatgcgtttattggtgtt
cgtaacggtaatgctgatcatttagccaatgtgattgcgggcaatgaaaaggtattgacc
gcgcgattggaagatgcagctttcttctatgcggaagatcaaaagcgcagcattgctgac
gatgttgatcgtttgaaagctgttagtttccacgataaaatcagttccatgtacgacaaa
atggcccgaacaagggttatcgccgatttgttggcggatcgttttggcttatctgcgact
gataaggctgatctggaccgagccgcttcgatttacaaattcgaccttgtcacttcaatg
gttggtgagtttccagaattgcaaggtattatgggcgaacattatgcgcaattggcaggt
gagaaaccagctgttgcccaggctatcgctgagcattacgagccgatttctgcggatggt
gcgttgccagaaagcttagtcggcaccgtgcttgcgattgcggacaaattcgattcgtta
atgagtttcttcgcggttgatctgattccaagtggctcaaacgatccttatgcgctgcgc
cgtcaagcttacgggattgttcgaatgatcgccaaacatgattggccatttgccgttgct
gaactgcagacgacgattgctgatgccttgaaggcagcaggaaaaaccaataatcttgat
tttgctgcgcatcaacaggatttgaatgcattcatgattgaccgtgccaaacaagtcttg
caagctcagaagatccgccatgacattgtggatgcagtgacagttcgcgctgatgccgat
cttgccggtatcttggatgctgccaagatcctttctgcgcacgcggacgatactgatttc
aaacctgtcatggaagcacttggacgtgtgttgcggattaccaagaagcagcaggtaaaa
gtcgatgtggatacagcgaagtttgagaatccgagcgaaggtcagttgtatgatgcaacg
gtggcgactgccaagaagtttgatgatgaaccgacggaagccgattatcaggcgcttaag
gcactcgcagatccaattaatgcgtactttgatgccacaatggtcatggccgacgatcaa
gccattcgccaaaatcgcttggcagctttgcttcaacttgccgcattgatcaagcaattt
ggcgatgtgagtcaagtcattgttaagtag

DBGET integrated database retrieval system